KEGG   Arcobacter butzleri RM4018: Abu_0700Help
Entry
Abu_0700          CDS       T00600                                 

Gene name
trpB1
Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
abu  Arcobacter butzleri RM4018
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Abu_0700 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Abu_0700 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Abu_0700 (trpB1)
Enzymes [BR:abu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Abu_0700 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
711620..712828
Genome map
AA seq 402 aa AA seqDB search
MSNYIPKPSIFDPDEKGQFGIFGGQYVPETLMPILKDLELAYKKYRFDKEFWAEVNALLK
DYVGRENPLYFASNISKELDAKIYLKREDLNHTGAHKVNNVIAQGLLAKRMGKTKVIAET
GAGQHGVATATIAALMGLECTIFMGAKDVERQELNVFRMKLLGAKVISVQSGSKTLKDAM
NDAIRYWVTNARDTFYIIGTVAGPHPYPMMVRDFQSIIGYESRKQILEKEEKLPDYVVAC
IGGGSNAIGMFSHFLEDKDVRCIGIEAGGLGIDTNKHGCSLEKGTPGILHGQCSYLLQDE
DGQVLEAHSMSAGLDYPGIGPEHSFHKDNKSISYDSITDQEALDAFVWLSRREGIIPAFE
SAHAIAYLNKAKEKIKGKTVIVCLSGRGDKDMIQAKSLLNFN
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtaattatattccaaaacctagtatttttgacccagatgaaaaaggtcaatttggt
atttttggtggacaatatgttcctgaaactttgatgccaattttaaaagacttagaactt
gcatataaaaaatatagatttgataaagagttttgggcagaggttaatgctttattaaaa
gattatgtaggtagagaaaatccattatattttgcttcaaatataagtaaagagttagat
gcaaaaatttatttaaaaagagaagatttaaatcatactggtgctcataaagtaaataat
gtaatagctcaaggtctattagcaaaaagaatgggtaaaacaaaagtaattgcagaaaca
ggggctggacaacatggtgttgcaactgcaacaattgcagcactcatgggacttgaatgt
actatttttatgggtgcaaaagatgttgaaagacaagaactaaatgtttttagaatgaaa
cttttaggagcaaaagttatttcagttcaaagtggaagtaagactttaaaagatgctatg
aatgatgcaataagatattgggttacaaatgcacgagatactttttatataattggtaca
gttgctggccctcacccatatcctatgatggtgcgagatttccaatcaattattggttat
gaatcaagaaaacagattttagaaaaagaggaaaaacttcctgattatgtagttgcatgt
attggtggtggctcaaatgctattggtatgttttctcactttttagaagataaagatgta
agatgtattggaattgaagcaggtggattaggaattgatactaataaacatggatgttct
ttagaaaaaggaactccaggaattcttcatggtcaatgctcatatttgcttcaagatgaa
gatggacaagttttagaagcacatagtatgagtgcaggtcttgattatccaggaattggt
ccagaacactcttttcataaagataataaatcaataagttatgattcaattacagatcaa
gaagctttagatgcttttgtttggttaagtagacgtgagggaattattccagcatttgaa
tcagcgcacgcaattgcatatttgaataaagcaaaagagaaaataaaagggaaaacagtt
attgtttgtttatctggtaggggagataaagatatgattcaagcaaaaagtttgctgaat
tttaattaa

DBGET integrated database retrieval system