KEGG   Arcobacter butzleri RM4018: Abu_0744Help
Entry
Abu_0744          CDS       T00600                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
abu  Arcobacter butzleri RM4018
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:abu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Abu_0744 (ruvA)
Enzymes [BR:abu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Abu_0744 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
755090..755647
Genome map
AA seq 185 aa AA seqDB search
MIVGLIGKIIKKEPTQLNVNVNGVIYEVFVSLNCSSKIVSDDVKLEITHIIREDAQSLYG
FLDSNEKKLFDTVIKINGVGPKVALAICSTFTPTSFAQIVSSNDVSMLKRVPGIGPKGAS
RILVELSGFIIDSNDETSGSSSALEAALALESLGFKKDLVSSVLKTCVNSNTSDLVKEAL
KKLQK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgatagtaggacttataggaaaaataataaaaaaagaaccaacacagttaaatgtaaac
gtaaatggagttatttatgaggtttttgtttcattaaattgtagttcaaagattgtttct
gatgatgtaaaattggaaataactcatattataagagaagatgcacaaagtttatatggt
tttttggattcaaatgaaaaaaagctttttgatacagttataaaaataaatggagttgga
cctaaagttgcacttgcaatttgttctacttttacaccaacatcatttgcacaaatagta
agctcaaatgatgtttcaatgttaaaaagagttccaggaattggacctaaaggtgctagt
agaattttagtagaattatctggatttattattgattcaaatgatgaaacaagtggttca
tcttcagctttagaagctgccttagctttagaatctttaggatttaaaaaagatttagta
tcaagtgtattaaaaacttgtgttaattcaaatacaagtgatttagtaaaagaagcatta
aaaaaattacaaaaatag

DBGET integrated database retrieval system