KEGG   Arcobacter butzleri RM4018: Abu_0839Help
Entry
Abu_0839          CDS       T00600                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
abu  Arcobacter butzleri RM4018
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Abu_0839 (galU)
   00052 Galactose metabolism
    Abu_0839 (galU)
   00500 Starch and sucrose metabolism
    Abu_0839 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Abu_0839 (galU)
Enzymes [BR:abu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Abu_0839 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(844811..845668)
Genome map
AA seq 285 aa AA seqDB search
MKNPIKKCLFPAAGYGTRFLPATKATPKEMLPVLTKPLIQYGVEEAIAAGMDTMAIVTGR
GKRAIEDHFDISYELEHQIKGTNKEHYLTEIRSVITKCTFSYTRQIEMKGLGHAILCGET
LIGDQPFAVLLADDLCDAPTNGVLSQMVELYKKYHCSIVAIEEVPKEETNKYGVIAGNEI
EPGIYMIKDMVEKPEPEVAPSNLAIIGRYILTPDIFDIIKETKPGKGGEIQITDALLTQA
KKGMVLAYKFEGQRFDCGSVDGYVKATNYFYDKSTKKEKKEAGKK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatccaatcaaaaaatgtctattcccagctgcaggttatggaacaagattctta
ccagcaacaaaagcaacaccaaaagagatgctaccagtacttacaaaaccacttattcaa
tatggagtagaagaagcaattgctgctggcatggatacaatggcaattgtaacaggtaga
ggaaaaagagcaattgaagatcactttgatatctcttatgagttagaacatcaaattaaa
ggtacaaataaagaacattatttaactgaaattagatcagttattacaaaatgtacattt
tcatatactagacaaatagagatgaaaggtttaggacatgcaattttatgtggtgaaact
ttaattggagatcaaccttttgctgtacttttagcagatgacttatgtgatgcaccaaca
aacggagttttatctcaaatggttgagttatataaaaaatatcattgttcaattgtagct
attgaagaagttccaaaagaagaaacaaataaatatggtgttattgctggtaatgaaatt
gaaccaggaatttatatgattaaagacatggttgaaaaacctgaaccagaagttgctcct
tcaaacttagcaattattggaagatatattttaactcctgatatttttgatattataaaa
gagacaaaaccaggaaaaggtggagaaattcaaattacggatgcacttttaactcaagct
aaaaaaggaatggttttagcttataaatttgaaggtcaaagatttgattgtggaagcgta
gatggttatgtaaaagcaacaaattacttttacgataaatcaacaaaaaaagaaaagaaa
gaagctggtaagaaataa

DBGET integrated database retrieval system