KEGG   Arcobacter butzleri RM4018: Abu_0840Help
Entry
Abu_0840          CDS       T00600                                 

Definition
phosphohexosemutase (EC:5.4.2.-)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
abu  Arcobacter butzleri RM4018
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Abu_0840
   00030 Pentose phosphate pathway
    Abu_0840
   00051 Fructose and mannose metabolism
    Abu_0840
   00052 Galactose metabolism
    Abu_0840
   00500 Starch and sucrose metabolism
    Abu_0840
   00520 Amino sugar and nucleotide sugar metabolism
    Abu_0840
  Nucleotide metabolism
   00230 Purine metabolism
    Abu_0840
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Abu_0840
Enzymes [BR:abu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Abu_0840
    5.4.2.8  phosphomannomutase
     Abu_0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(845670..847046)
Genome map
AA seq 458 aa AA seqDB search
MSASIFREYDIRGIFEKELNEDVVKKIGYYLAKALQKKVPNAVYMAVGYDARLHSPTLKN
WLSSGINKAGLKVLDMGLVPTPANYFANFTDFDGLKCDGSVMITGSHNPPEYNGFKITLD
KDPFFGEDIYALGREILADNTTIEDNEKTILIDSKNRYIDYIVKSFSHLKLENKKFVFDC
GNGVAGVVLREILDRLNIKYKILFEEPDGNFPNHHPDPSDEHTLEDIKKELASGEFDFGF
AYDGDADRIALLSPKYNFKGDILAIFFSRFIKNPTVIGEVKCTQVMYDTINSYGKAIMYK
TGHSNLKVKIKETKADFAAEVSGHLFFNDRYFGYDDAIYATFRALELIDQNFDFDKEYEA
LPKVYSTPEINITVTEETKFKIIEDLKNALTNPPADFPKIKDIITVDGIRVIFEKGWGLV
RASNTTPKLVTRFEADTKENAKIYEEVLINLFNKLQGK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcatctatttttagggaatatgatattagaggaatattcgaaaaagagttaaat
gaagatgtagtaaagaaaattggttattatttagctaaagctttacaaaaaaaagttcca
aatgctgtttatatggctgttggctatgatgcaagacttcattctccaactttgaaaaac
tggttaagttcaggaataaacaaagccggattaaaagttttagatatgggattagttcca
actcctgcaaattattttgcaaactttaccgattttgatggtttaaaatgtgatggttca
gtaatgataacaggtagtcataatccaccagaatataatggatttaaaattactttagac
aaagatccattttttggtgaagatatttatgcattaggaagagaaattcttgcagataat
acaacaatagaagataatgaaaaaactattttgattgattctaagaatagatatatagat
tatatagtaaaaagcttttcacacttgaaactcgaaaataaaaaatttgtttttgactgt
ggaaatggtgttgctggtgttgttttaagagaaattcttgatagattaaatattaaatat
aaaattttatttgaagaaccagatggtaatttcccaaatcaccatccagatccaagtgat
gaacacactttagaagacataaaaaaagagttagcaagtggtgaatttgattttggattt
gcttacgatggtgatgcagatagaattgccctactttctccaaaatataattttaaagga
gatatattagcgatatttttctctcgattcatcaaaaaccctacggtaatcggtgaagta
aaatgtactcaagttatgtatgatactattaattcttatggaaaagctatcatgtacaaa
acaggtcattcaaatttaaaagtaaaaataaaagagacaaaagcagattttgcagctgaa
gtttctggacatttattcttcaatgacagatattttggttatgatgatgctatttatgca
acatttagagctttagaattaattgaccaaaattttgattttgacaaagagtatgaagct
ttaccaaaagtttattcaactccagaaataaatataactgtaacagaagaaacaaaattt
aaaataattgaagatttaaaaaatgctttaacaaatccacctgctgattttccgaaaatc
aaggatatcatcacagttgatggaatcagagttatttttgaaaaaggttggggattagta
agagctagtaacacaactccaaaattagtgacaagatttgaagcagatacaaaagaaaat
gcaaaaatctatgaagaagttttaataaatctatttaataaattacaaggaaaataa

DBGET integrated database retrieval system