KEGG   Arcobacter butzleri RM4018: Abu_0840Help
Entry
Abu_0840          CDS       T00600                                 

Definition
(GenBank) phosphohexosemutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
abu  Arcobacter butzleri RM4018
Pathway
abu00010  Glycolysis / Gluconeogenesis
abu00030  Pentose phosphate pathway
abu00051  Fructose and mannose metabolism
abu00052  Galactose metabolism
abu00230  Purine metabolism
abu00500  Starch and sucrose metabolism
abu00520  Amino sugar and nucleotide sugar metabolism
abu00521  Streptomycin biosynthesis
abu01100  Metabolic pathways
abu01110  Biosynthesis of secondary metabolites
abu01120  Microbial metabolism in diverse environments
abu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:abu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Abu_0840
   00030 Pentose phosphate pathway
    Abu_0840
   00051 Fructose and mannose metabolism
    Abu_0840
   00052 Galactose metabolism
    Abu_0840
   00500 Starch and sucrose metabolism
    Abu_0840
   00520 Amino sugar and nucleotide sugar metabolism
    Abu_0840
  Nucleotide metabolism
   00230 Purine metabolism
    Abu_0840
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Abu_0840
Enzymes [BR:abu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Abu_0840
    5.4.2.8  phosphomannomutase
     Abu_0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ABV67105
UniProt: A8ET31
Position
complement(845670..847046)
Genome map
AA seq 458 aa AA seqDB search
MSASIFREYDIRGIFEKELNEDVVKKIGYYLAKALQKKVPNAVYMAVGYDARLHSPTLKN
WLSSGINKAGLKVLDMGLVPTPANYFANFTDFDGLKCDGSVMITGSHNPPEYNGFKITLD
KDPFFGEDIYALGREILADNTTIEDNEKTILIDSKNRYIDYIVKSFSHLKLENKKFVFDC
GNGVAGVVLREILDRLNIKYKILFEEPDGNFPNHHPDPSDEHTLEDIKKELASGEFDFGF
AYDGDADRIALLSPKYNFKGDILAIFFSRFIKNPTVIGEVKCTQVMYDTINSYGKAIMYK
TGHSNLKVKIKETKADFAAEVSGHLFFNDRYFGYDDAIYATFRALELIDQNFDFDKEYEA
LPKVYSTPEINITVTEETKFKIIEDLKNALTNPPADFPKIKDIITVDGIRVIFEKGWGLV
RASNTTPKLVTRFEADTKENAKIYEEVLINLFNKLQGK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcatctatttttagggaatatgatattagaggaatattcgaaaaagagttaaat
gaagatgtagtaaagaaaattggttattatttagctaaagctttacaaaaaaaagttcca
aatgctgtttatatggctgttggctatgatgcaagacttcattctccaactttgaaaaac
tggttaagttcaggaataaacaaagccggattaaaagttttagatatgggattagttcca
actcctgcaaattattttgcaaactttaccgattttgatggtttaaaatgtgatggttca
gtaatgataacaggtagtcataatccaccagaatataatggatttaaaattactttagac
aaagatccattttttggtgaagatatttatgcattaggaagagaaattcttgcagataat
acaacaatagaagataatgaaaaaactattttgattgattctaagaatagatatatagat
tatatagtaaaaagcttttcacacttgaaactcgaaaataaaaaatttgtttttgactgt
ggaaatggtgttgctggtgttgttttaagagaaattcttgatagattaaatattaaatat
aaaattttatttgaagaaccagatggtaatttcccaaatcaccatccagatccaagtgat
gaacacactttagaagacataaaaaaagagttagcaagtggtgaatttgattttggattt
gcttacgatggtgatgcagatagaattgccctactttctccaaaatataattttaaagga
gatatattagcgatatttttctctcgattcatcaaaaaccctacggtaatcggtgaagta
aaatgtactcaagttatgtatgatactattaattcttatggaaaagctatcatgtacaaa
acaggtcattcaaatttaaaagtaaaaataaaagagacaaaagcagattttgcagctgaa
gtttctggacatttattcttcaatgacagatattttggttatgatgatgctatttatgca
acatttagagctttagaattaattgaccaaaattttgattttgacaaagagtatgaagct
ttaccaaaagtttattcaactccagaaataaatataactgtaacagaagaaacaaaattt
aaaataattgaagatttaaaaaatgctttaacaaatccacctgctgattttccgaaaatc
aaggatatcatcacagttgatggaatcagagttatttttgaaaaaggttggggattagta
agagctagtaacacaactccaaaattagtgacaagatttgaagcagatacaaaagaaaat
gcaaaaatctatgaagaagttttaataaatctatttaataaattacaaggaaaataa

DBGET integrated database retrieval system