KEGG   Arcobacter butzleri RM4018: Abu_0886Help
Entry
Abu_0886          CDS       T00600                                 

Definition
cytochrome c peroxidase (EC:1.11.1.-)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
abu  Arcobacter butzleri RM4018
Brite
Enzymes [BR:abu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Abu_0886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
885240..886157
Genome map
AA seq 305 aa AA seqDB search
MIKSIIFLTIGFSFLYSQEPITAIPTKINVDKNKVNLGKELFFDKRLSKDETISCHSCHS
FSHGGADDKKFSLGIEKKVGDINTPTVFNSVFNFAQFWNGRSKNLYEQAIGPITKDNEMG
MNLQELVIKLNNTEYKNKFKKIYEDGITQNNLIDAIVEYEKTLITPNSRFDRYLKGEKDA
ITQEEKRGYIIFKEQGCIACHHGTNVGGNLYARFGVVDKVNSISKGRFEVTKNEDDLYYF
KVASLRNVQFTSPYLHDGRFDNLSDTVKFMANYQLGKSLSEEDIDSIVSFLKSLTGELYD
YQEEQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
ttgataaaatctattatatttttaactattggattttcttttttgtattcacaagaacca
attacggcaattcctacaaaaattaatgttgataaaaataaagttaatttagggaaagaa
cttttttttgataaaagattatctaaagatgaaactatttcttgtcattcttgtcattcg
tttagccatggaggggctgatgataaaaaattttctttgggaattgaaaagaaagttgga
gatataaatactcctacagtatttaatagtgtatttaattttgcacaattttggaatgga
agatcaaaaaacctttatgaacaagctattggacctattacaaaagataatgaaatggga
atgaatcttcaagagttagttattaaactaaataatacggaatataaaaataaatttaaa
aagatttacgaagatggtattactcaaaataatttaatagatgcaattgttgaatatgaa
aagactttgattactccaaattctcgttttgatagatatttaaaaggagaaaaagatgct
ataacacaggaagaaaaacgaggatatattatatttaaagaacaaggttgtattgcctgt
catcatggtacaaatgtgggtggaaatttatatgctagatttggcgttgtagataaagtc
aattctatttctaaaggaagatttgaagtaacaaagaatgaagatgatttatattatttt
aaagtagcaagtttaagaaatgttcaatttacatcaccatatttgcacgatggaagattt
gataatttatctgacactgtaaaatttatggcaaattatcaattaggtaaatctttaagt
gaagaagatattgatagcatagtttcatttttaaaatctttaactggagaattgtatgat
tatcaagaagaacaatag

DBGET integrated database retrieval system