KEGG   Arcobacter butzleri RM4018: Abu_1035Help
Entry
Abu_1035          CDS       T00600                                 

Definition
glycosyl hydrolase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
abu  Arcobacter butzleri RM4018
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Abu_1035
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Abu_1035
Enzymes [BR:abu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Abu_1035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1043575..1044669
Genome map
AA seq 364 aa AA seqDB search
MIKKFLILAILFVSNSLFADENYSKAQIEKMIAKMVILGFNGTSVDKNDEIYKNIQSGLG
GVILFDKDPNDKTKIKNIKDKNQLKNLNTQLQAISNQKLLISIDQEGGVVQRLKKDSGFV
DTLSAKDIATNGEDFAKQSYKALAKDLKDVGINLDFAPVVDLSINKNNKVIVTRGRSFGE
SSSEVIKYSSIFVDELRKQNVISVLKHFPGHGSSLADSHLGFVDITKTWNQKELEPYKYF
IKNNDVDMIMTAHVFNENLDKNYPATLSYNINTKLLREDLGYKGVLVTDDLQMSAISKHY
DLKQTLTLAINSGVNMLLFANQLAKPVTLKEIVDTVYLQIQNKQISLQKIIDSNNKIDKL
LKKI
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaagtttttgattttagctattttatttgtatcaaatagcttatttgcagat
gaaaattattcaaaagcacaaatagaaaagatgatagcaaagatggttattttaggtttt
aatggtacaagtgtagataaaaatgatgaaatatataaaaacatacaatcaggacttggt
ggtgtaatactatttgataaagacccaaatgataaaacaaagataaaaaatataaaagat
aaaaatcagttaaaaaatcttaatacacagcttcaagcaatttcaaatcaaaaattgtta
atttctattgatcaagaaggtggagtagtacaaagacttaaaaaagatagtggttttgta
gatactttaagtgcaaaagatattgctacaaatggtgaagattttgctaaacaaagttat
aaagcacttgctaaggatttaaaagatgttggaataaatctcgattttgctccagttgtt
gatttatctataaataaaaacaataaagttatcgtaacaagaggaagaagctttggtgaa
agttcaagtgaagttataaaatactcttcgatttttgttgatgaactaagaaaacaaaat
gtaatttcagttttaaaacactttcctggacatggttcatctttagctgattctcattta
ggatttgtagatattacaaaaacttggaatcaaaaagagcttgaaccatataaatatttt
ataaaaaataatgatgtagatatgattatgacagctcatgtatttaatgaaaatttagat
aaaaactatcctgcaactttgtcatacaatataaatacaaaactgcttagagaagatttg
ggatataaaggagttcttgtaacagatgatttacaaatgagcgctatttcaaaacattat
gatttaaaacagactttaactttagctataaattctggagttaatatgctgctttttgca
aatcagttagcaaaaccagttactttaaaagagattgtagatactgtttatttacaaatt
caaaataaacaaataagtttgcaaaagattatagattcaaataataaaatagataagtta
ctaaaaaaaatataa

DBGET integrated database retrieval system