KEGG   Arcobacter butzleri RM4018: Abu_1055Help
Entry
Abu_1055          CDS       T00600                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
abu  Arcobacter butzleri RM4018
Brite
Enzymes [BR:abu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Abu_1055
Secretion system [BR:abu02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Abu_1055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1060882..1061622)
Genome map
AA seq 246 aa AA seqDB search
MFNLTKKIVMILLFIGTFLFAENKELPKNEISKIEQLEIFKKANIKILKAYDAGSLYILT
ISVHGNKDEIYLTKDKKFIISGTVVNVSNEMQVSAPVDLSITKDKEAFVYGNGKDEYVLF
TDPECPFCKKFESYLPEIKDKVKIRVFFYPLDFHENARDLSLYILSQKTTSQKIDALYEF
NIGDNLSKVKNAKYSKSELSKLEKQLNEHIKIATELNIQGTPALFDKNGNSIVWVNMLEK
YGIEVR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatctaacaaaaaaaatagttatgattttattatttattggaacatttttattt
gcagaaaataaagaattaccaaaaaatgaaatttctaaaatagaacaattagaaatattt
aaaaaagcaaatataaaaatcttaaaagcttacgatgctggaagtttatatatattaact
atcagtgtacatggaaataaagatgaaatttatctaacaaaagataaaaaatttattatc
tctggtacagttgtaaatgtatcaaatgagatgcaagtttcagctccagttgatttatca
attacaaaagataaagaagcttttgtttatggaaatggaaaagatgaatatgtactattt
acagatcctgaatgtccattttgtaaaaaatttgagtcatatttaccagaaattaaagac
aaagttaaaattagagtatttttttatcctttagactttcatgaaaatgctcgtgattta
tctttatacattctaagtcaaaaaacaacttcacaaaaaattgatgctctatatgaattt
aatattggtgataacttgagtaaagtaaaaaatgcaaaatactcaaaatcagagctttca
aaacttgaaaaacagttaaatgaacatattaaaattgcaactgaattaaatattcaagga
actcctgcattatttgataaaaatggtaatagtatcgtttgggttaatatgctagaaaaa
tatggtattgaagtaagataa

DBGET integrated database retrieval system