KEGG   Arcobacter butzleri RM4018: Abu_1150Help
Entry
Abu_1150          CDS       T00600                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
abu  Arcobacter butzleri RM4018
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Abu_1150 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    Abu_1150 (dapE)
Enzymes [BR:abu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Abu_1150 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1155252..1156352
Genome map
AA seq 366 aa AA seqDB search
MSVIELFQKLLKFKSITPNDDGAFDFIQEYLGNEWNCIKVDMEGVKNRFYYKKFNDTKQH
LCFAGHIDVVPVGNGWEVDPFAAEVIDGVITARGAQDMKSGDAAFLYACKNAKNFDGTLS
ILMTSDEEGEGTYGTIKMLEHLKQINMIPNYAVVAEPTCEEVFGDAIKVGRRGSINGYIT
IKGKQGHAAYPEKCINPVHNFAHILPKIAGINLDNGDEYFAPSKLVITDIRAGMEVTNVT
PNELKIMFNVRNSTNTTKEDVENFINQNLKGLDYDFRITQGSFPFVTNKTSKVVIAMENS
IYDILKIKTKHSTAGGTSDARYFGAFGIEAIEFGVINDTIHSINEKTTVKEVEGLTEVFE
NLIKNF
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttatagaactatttcaaaaattattaaaatttaaatcaataactccaaatgat
gatggtgcgtttgattttatacaagaatatttaggaaatgaatggaattgtataaaagtt
gatatggaaggtgtaaaaaatagattttattataaaaaatttaacgatacaaaacaacat
ctatgttttgcgggtcatatagatgttgttcctgttggcaatggttgggaagttgatcct
tttgccgctgaagttatagatggagtaataactgcacgaggtgctcaagatatgaaaagt
ggagatgctgcttttttatacgcttgtaaaaatgcaaaaaactttgatggaacattgagt
attttgatgacttctgatgaagaaggtgagggaacttacggaactattaaaatgcttgaa
catttaaaacagataaatatgattccaaattatgcagttgtagcagaaccaacttgtgaa
gaagtttttggagatgccataaaagttggtcgaagaggaagtataaatggatatattaca
ataaaaggaaaacaaggtcacgctgcgtatccagaaaagtgtataaatcctgtacataat
tttgcacatattttacccaaaattgcaggtataaatcttgacaatggtgatgaatatttt
gcaccttcaaaacttgtaataactgatattagagcaggaatggaagttacaaacgtaaca
ccaaatgaattaaaaattatgtttaatgtaagaaactcgacaaatacaacaaaagaagat
gtcgagaattttataaatcaaaatttaaaaggtttagattatgattttagaataacacaa
ggttcttttccttttgttacaaataaaacttcaaaagtagtaattgctatggaaaattct
atttatgacattttgaaaatcaaaacaaaacactcaacagctggtggtacaagtgatgct
agatattttggtgcttttggtattgaagcaatagaatttggtgtaattaatgatacaata
catagtataaatgaaaaaacaacagtcaaagaagttgaaggattgactgaggtttttgaa
aatttgattaaaaacttctaa

DBGET integrated database retrieval system