KEGG   Arcobacter butzleri RM4018: Abu_1177Help
Entry
Abu_1177          CDS       T00600                                 

Gene name
hemD
Definition
uroporphyrinogen III cosynthase HemD (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
abu  Arcobacter butzleri RM4018
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Abu_1177 (hemD)
Enzymes [BR:abu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Abu_1177 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1183119..1183748
Genome map
AA seq 209 aa AA seqDB search
MKKIYLLNEQKHEDVENLEVFQIEYIKSYVDLKKYDALVFTSKNGVKAINSFNQDWKSIP
SYAIAQKTANTIIKLGGVVEFIGNSGHGNDFAYELKNVLKDKKVLYVKALKTVSNLPNIL
KENGISLDEIIAYKTSCKKLNIILEENSIFIFTSPSSVECFFKQYSWKNSYKAIVIGKTT
AEFLPSNINYEISSQTSVEECIKLAKQLS
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatatatttattaaatgaacaaaaacatgaagatgttgaaaatttagaagtt
tttcaaatagagtatataaaatcatatgttgatttaaaaaaatatgatgctttagttttt
acatcaaaaaatggtgtaaaggctataaactcttttaatcaagattggaaaagtattcct
tcttatgcgatagctcaaaaaacagcaaatactataataaaattgggtggagttgtcgaa
ttcataggaaactctgggcatggaaatgattttgcttatgaattaaaaaatgttttaaaa
gataaaaaagttttatatgttaaggctttaaaaacggtttcaaatttgccaaatatttta
aaagaaaatggtatttctttagatgaaataatcgcttataaaacttcttgtaaaaaatta
aatattattttagaagaaaattctatatttatatttacttctccttcaagtgttgaatgt
ttttttaaacaatattcgtggaaaaactcatataaagctatcgttattggaaaaactaca
gctgagtttttaccttcaaatataaattatgaaattagttctcaaacttcagttgaagag
tgtataaagttagctaaacaactctcttaa

DBGET integrated database retrieval system