KEGG   Arcobacter butzleri RM4018: Abu_1188Help
Entry
Abu_1188          CDS       T00600                                 

Gene name
cheB
Definition
protein-glutamate methylesterase CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
abu  Arcobacter butzleri RM4018
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:abu02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:abu02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1194836..1195915
Genome map
AA seq 359 aa AA seqDB search
MYTVLVIDDSASMRSILKDMINSIEDFEVIAVATDAYDAREKIKEYEPDLVTIDINMPKM
DGVTFLRNLMRLHPMPAVVISGESVRGNDIFDDGAVGFIPKPNSGEPMSNFEARIKDTLL
NLTFLLSRYTLKKSPAIKKPTTYKSTHNVDYKVHPDEVIPLRAAKFPGAKIIAIGSSTGG
VESLLRVFKRLPSGLPPIVITQHIPYGFSNSLAHRLNDHSEVEVCEAKDGLTLEKGHAYL
APGNMHLTIEKYGNDFKTRLLDTKKVSQHKPSVDVLFRSVNNAVGGGAMAVMMTGMGDDG
TIAMKELFDNGAYTIAQNEASCVVFGMPMKAIQAGAVKDIVHLDEIADYIIDFSKGKLK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtacacagttttagttatagatgattctgcttcaatgagaagtatacttaaagatatg
ataaattctattgaagattttgaagtaatagctgtagcaactgatgcttacgatgctaga
gaaaaaatcaaagagtacgaaccagatttagtaacaatagatataaatatgcctaaaatg
gatggtgttacattcttaagaaatttaatgcgtcttcatcctatgccagcagttgtaatc
tctggagaaagtgttagaggaaatgatatttttgatgatggagcagtaggttttattcct
aaaccaaactctggtgaacctatgtcaaattttgaagctagaataaaagatactttgtta
aatttaacattccttttgagccgatatactttaaaaaaatcgcctgctatcaaaaaacca
acaacttataaatcaacacataatgttgattacaaagtacatcctgatgaagttatacct
cttagagcagcaaaattcccaggagcaaaaataatagcaattggttcatcaacaggtgga
gttgaatctttattaagagtttttaaaagacttcctagtggattacctccaattgttata
actcaacatattccttatggtttttcgaactctttagctcatagattaaatgatcattca
gaagttgaagtttgtgaagcaaaagatggattgaccttagaaaaaggacatgcatattta
gccccaggaaatatgcatttaacaatcgaaaaatatggaaatgattttaaaacgagatta
cttgatacaaaaaaagtaagccagcataaaccaagcgttgatgttctttttagatcagtt
aataatgctgttggtggtggagcaatggctgttatgatgacaggtatgggagatgatgga
acaatagccatgaaagaattatttgataatggagcatatacaattgcgcaaaatgaagca
agttgtgtagtatttggtatgcctatgaaagcaatacaagcaggagctgttaaagatata
gttcatttagatgaaattgctgattatattattgatttttcaaaggggaagcttaaataa

DBGET integrated database retrieval system