KEGG   Arcobacter butzleri RM4018: Abu_1202Help
Entry
Abu_1202          CDS       T00600                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
abu  Arcobacter butzleri RM4018
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:abu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1206914..1208053
Genome map
AA seq 379 aa AA seqDB search
MKTYKISLNDSKKFFENLGCDSGGISILSKKSKLHTLYIKDLHVGAANILKQDALSIGAD
LAVPNGVIIAKDKYVNALLIGTTKHFENLAKKELAQPFGLKELAKSLKDYVKEQNYPTKI
MGVLNANEDSFFKNSRFDNSEACQRIEKMIEDGANIIDIGAVSSRPGSLPVSENIELDRL
KDIVQTIYQNKYYEKVDFSIDSFSPKVIEYVLNHGFKIVNDITGLQNDEVCKLVSKYNAQ
AVIMHMQNNQTNMQEAPFYEDVIVEIDDFFTKRLEKVKSFGVKDIVLDVGIGFGKTLEHN
LLLLKNLEHFKHFGYELLIGASRKSMIDKITPTEVINRLPGTLAIHLESIRNGASIIRCH
DVKEHFQAIKVFEAIENIN
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatataaaatatcactaaatgattcaaaaaagttttttgaaaatcttggttgt
gatagtggcggtatttcgattttatcaaaaaaatcaaaacttcatactttatatataaaa
gatttacatgttggtgctgcaaatattttaaaacaagatgctttatctattggagcagat
ttagctgtaccaaatggagttataattgcaaaagataaatatgtaaatgccttacttata
ggaactacaaaacattttgagaatttagcaaaaaaagagttagcacaaccttttggatta
aaagagttagcaaaatctttaaaagattatgtaaaagaacaaaactatcctacaaaaata
atgggtgttttaaatgcaaatgaggattcattttttaaaaatagtagatttgataactct
gaagcttgtcaaagaatagaaaaaatgatagaagatggtgcaaatataatagatattggt
gcagtttcaagtcgtcctggaagtttaccagttagtgaaaatatagaacttgatagacta
aaagatatagttcaaactatttatcaaaataaatattatgaaaaagttgatttttccata
gattctttttctccaaaagttatagaatatgttttaaatcatggctttaaaatagtaaat
gatataacaggtttgcaaaatgatgaagtttgtaaacttgtatcaaaatataacgctcaa
gcagttattatgcatatgcaaaataatcaaacaaatatgcaagaagctcctttttatgaa
gatgttatagttgaaattgatgatttttttaccaaacgattagaaaaagtaaaaagtttt
ggggtaaaagatatagttttagatgtgggtattggttttggaaaaactttggaacacaac
ctactcttacttaaaaatttagaacattttaaacactttggatatgagttactaattggt
gcaagtagaaaatccatgatagataaaataacaccaactgaagttataaatagacttcca
ggaactttggctattcatttagaatctattagaaatggtgcttcaattattagatgccat
gatgtaaaagaacactttcaagcaataaaagtttttgaagcgatagaaaatataaattaa

DBGET integrated database retrieval system