KEGG   Arcobacter butzleri RM4018: Abu_1295Help
Entry
Abu_1295          CDS       T00600                                 

Gene name
trpB2
Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
abu  Arcobacter butzleri RM4018
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Abu_1295 (trpB2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Abu_1295 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Abu_1295 (trpB2)
Enzymes [BR:abu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Abu_1295 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1293505..1294722
Genome map
AA seq 405 aa AA seqDB search
MNKSYLESMPDANGFFGKFGGSFIPPELEKPFEEIKKAYEELKNSPKFIEELKYVRKHYQ
GRPTPISFAKNLTQFCGGAKIYLKREDLNHTGAHKLNHCMAEVILAKHLGKKKVIAETGA
GQHGVALATAAAYFGLECEIHMGEVDIAKEHPNVVRMKILGAKVVPATHGLKTLKEAVDS
AFEAYLADTKNSIYCIGSVVGPHPFPMMVRDFQSVIGFEAREQFLEHEGKLPDAVAACVG
GGSNAMGIFSGFIDDKQVELYGVEPMGKGNKIGEHSASLTYGEEGIMHGFNSIMLKDKDG
NPAPVYSIGSGIDYPSVGPEHAYLKETGRSKVGLCNDNEAVDAFYKLSQLEGIIPALESA
HAVGFAMKLAKTLDKEKTILISLSGRGDKDIDFVINNYPIPNSKF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatcatatttagaaagtatgcctgatgctaatggtttttttggtaaatttgga
ggttcctttattcctcctgaattagaaaaaccttttgaagagatcaaaaaagcttatgaa
gaattaaaaaattctcctaaatttatagaagagttaaaatatgttagaaaacactatcaa
ggaagaccaactccaatctcatttgcaaaaaatctaacacaattttgtggtggagcaaaa
atttatctaaaaagagaagatttaaatcatactggtgctcataaattaaaccattgtatg
gctgaagtaatcttagcaaaacatcttggaaagaaaaaagtaatagctgaaacaggagct
ggtcaacacggtgttgcacttgcaactgctgcggcttattttgggcttgaatgtgaaatt
catatgggtgaagttgatattgcaaaagagcatccaaatgttgttagaatgaaaattctt
ggagcaaaagtagttccagcaactcatggacttaaaactttaaaagaagctgttgattca
gcatttgaagcatatttggctgatacaaaaaactctatttattgtattggttctgttgtt
ggtccacatccatttcctatgatggtaagagatttccaaagtgttattggatttgaagca
cgtgagcaatttttagaacatgaagggaaacttccagatgccgttgccgcttgtgttggt
ggtggaagtaatgctatgggaattttctctggatttattgatgataaacaagttgaactt
tatggtgttgaaccaatgggaaaaggtaataaaataggtgaacactcagcatctttaact
tatggagaagaaggaattatgcatggattcaactctattatgttaaaagataaagatgga
aacccagctcctgtttactctattggaagtggaattgattatccaagcgttggaccagaa
cacgcttatttaaaagaaactggaagaagtaaagttggactttgtaatgataatgaagct
gttgatgcattttataaattatctcaactagaaggaatcattcctgctttagagtcagct
catgcagttggatttgctatgaaattagcaaaaactttagataaagaaaaaactatttta
ataagtcttagtggtcgtggggataaagatattgattttgttattaataactaccctatt
cccaattcaaaattttaa

DBGET integrated database retrieval system