KEGG   Arcobacter butzleri RM4018: Abu_1321Help
Entry
Abu_1321          CDS       T00600                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
abu  Arcobacter butzleri RM4018
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Abu_1321
Enzymes [BR:abu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Abu_1321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1323468..1324046
Genome map
AA seq 192 aa AA seqDB search
MVDKDTIKLLSDLSFSMFSKNFFGIYHGAISSKLDQYNFMINTSDAIFDKMDEKSFCTLN
MNKQDYRWNIASIESHIHSTIYTNIHEAKYIAFGMPIYTTAYTLLHDKIVFEDFFGKTFF
GELSIYNPGDFSTWYKRNALEITKYLKESEHNLMVIKGVGTYVYDRDVYELVKKIAILEN
SCRLLSIKSSFE
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggtagataaagatactataaaattactctctgatttatcattttctatgtttagtaag
aacttttttggtatctatcatggtgcaatttcttctaaacttgatcaatataactttatg
ataaatacgagtgatgctatatttgacaaaatggatgaaaaatctttttgtactttaaat
atgaataaacaagattacagatggaatattgctagtatcgaatctcatattcattcgaca
atatatacaaatatccatgaagcaaaatatattgcttttggtatgccaatttatacaaca
gcatatacattacttcatgacaaaatagtatttgaagatttttttggtaaaacttttttt
ggagaattatctatttataatcctggtgatttttcaacttggtataaaagaaatgccctt
gaaattacaaaatatttaaaagaatctgaacataatttgatggttataaaaggtgtagga
acttatgtatatgatagagatgtttatgaactagttaaaaaaatagctattcttgagaat
tcttgtagacttttaagtataaaaagttcttttgaataa

DBGET integrated database retrieval system