KEGG   Arcobacter butzleri RM4018: Abu_1520Help
Entry
Abu_1520          CDS       T00600                                 

Definition
phage-related lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
abu  Arcobacter butzleri RM4018
Brite
Enzymes [BR:abu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Abu_1520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1527931..1528416
Genome map
AA seq 161 aa AA seqDB search
MSAIEIVLPFTAQSEGFSKTVYKCPAGFDTIGYGRNIQANPLNQDELKSIGATTSTSKTS
YQVSEEIAKTWLKKELERVKNALSKELSFFDKLDDVRQAILIDMAYNMGIKGLLSFKNTL
KLISDGKYVEASINMEQSNWYKQVKTRAKKLCEAMKTGILK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaatagaaattgtactaccttttacggcacaaagtgaaggttttagtaaaaca
gtttataaatgtcctgctggatttgacactattggttatggaagaaatattcaagcaaat
cctttgaaccaagatgaattaaaaagtattggtgcaactactagtacttcaaaaacaagc
tatcaagtaagtgaagaaatagctaaaacttggttaaaaaaggagcttgagagagttaaa
aatgccctatcaaaagagttgtcattttttgataaattagatgatgtaagacaagctatt
ctaatagatatggcttacaatatgggaataaaagggctacttagctttaaaaatactctt
aagctaataagtgatggaaagtatgttgaagcttctataaatatggaacaaagtaattgg
tataaacaggtaaaaactagagctaaaaaactttgtgaagctatgaaaactggaatcttg
aaataa

DBGET integrated database retrieval system