KEGG   Arcobacter butzleri RM4018: Abu_1569Help
Entry
Abu_1569          CDS       T00600                                 

Gene name
speB
Definition
arginase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
abu  Arcobacter butzleri RM4018
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Abu_1569 (speB)
Enzymes [BR:abu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Abu_1569 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1582459..1583520
Genome map
AA seq 353 aa AA seqDB search
MSYRTLEEEIKVLELGLPPQEGDGFIGGRLDPKEASLVLVPVPWEATVSFGQGTANAPDA
IRTSSHQLDVENYHYIKPYTAGIAMLETDKSLHKLSNKARKKALKVIEALEDGNTNEKAL
KYVNEASATLNSSVYEKSLEQIKKGKFVAVVGGDHSCPLGLIKALSDTQKESFGILHVDA
HHDLREAYEGFTYSHASIFYNVMKECEKVSNLVQVGIRDYSKEEATRMINYGSKGACLYD
TLMQSELASGKSLEEVFAPYINQLPQNVYLSIDIDGLEPLNCPNTGTPVPGGLRYGELEH
LIFMVVKAGKNIIGFDLCEVGDSADGWDANVGSRVLYQLCGALLASQGKIEYK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatagaactttagaagaagagataaaagtattagaactaggtcttcctccacaa
gaaggtgatggatttatcggtggaagattagacccaaaggaagctagtttagttttagtt
cctgttccttgggaagctactgtttcatttggacaaggaactgcaaatgctcctgatgca
atcagaacttcaagccatcaattagatgtagaaaactatcactatatcaaaccatatact
gctggtattgctatgcttgagactgataaaagtttacataaacttagcaacaaagcaaga
aaaaaagctttaaaagttattgaagctcttgaagatggaaatacaaatgaaaaagcatta
aaatatgtaaatgaagcttcagctactctaaactcatcagtttatgaaaaatctcttgaa
caaataaaaaaagggaaatttgtagcagttgttggaggtgatcactcttgtcctcttgga
cttatcaaagctttaagtgatactcaaaaagagtcttttgggattttacatgttgatgct
caccacgatttaagagaagcttatgaaggttttacttactctcacgcttcaattttttat
aacgttatgaaagaatgtgaaaaagtttcaaatctagttcaagttggtattcgtgattat
agtaaagaagaagcaactagaatgattaattatggttcaaaaggtgcctgtttatatgat
actttaatgcaatcagaacttgctagtggaaaatcgcttgaagaggtttttgcaccatat
ataaatcaacttccacaaaatgtttatttatcaatagatattgatggattagagccatta
aactgtccaaatacaggaactccagttccaggaggattaagatatggagagcttgagcat
ctaatatttatggttgtaaaagctggtaaaaatatcataggatttgacctttgtgaagtt
ggcgatagtgctgatggttgggatgcaaatgttggctcaagagttttataccaattatgt
ggtgcattacttgcaagtcaagggaaaatagaatacaaataa

DBGET integrated database retrieval system