KEGG   Arcobacter butzleri RM4018: Abu_1569Help
Entry
Abu_1569          CDS       T00600                                 

Gene name
speB
Definition
arginase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
abu  Arcobacter butzleri RM4018
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:abu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1582459..1583520
Genome map
AA seq 353 aa AA seqDB search
MSYRTLEEEIKVLELGLPPQEGDGFIGGRLDPKEASLVLVPVPWEATVSFGQGTANAPDA
IRTSSHQLDVENYHYIKPYTAGIAMLETDKSLHKLSNKARKKALKVIEALEDGNTNEKAL
KYVNEASATLNSSVYEKSLEQIKKGKFVAVVGGDHSCPLGLIKALSDTQKESFGILHVDA
HHDLREAYEGFTYSHASIFYNVMKECEKVSNLVQVGIRDYSKEEATRMINYGSKGACLYD
TLMQSELASGKSLEEVFAPYINQLPQNVYLSIDIDGLEPLNCPNTGTPVPGGLRYGELEH
LIFMVVKAGKNIIGFDLCEVGDSADGWDANVGSRVLYQLCGALLASQGKIEYK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatagaactttagaagaagagataaaagtattagaactaggtcttcctccacaa
gaaggtgatggatttatcggtggaagattagacccaaaggaagctagtttagttttagtt
cctgttccttgggaagctactgtttcatttggacaaggaactgcaaatgctcctgatgca
atcagaacttcaagccatcaattagatgtagaaaactatcactatatcaaaccatatact
gctggtattgctatgcttgagactgataaaagtttacataaacttagcaacaaagcaaga
aaaaaagctttaaaagttattgaagctcttgaagatggaaatacaaatgaaaaagcatta
aaatatgtaaatgaagcttcagctactctaaactcatcagtttatgaaaaatctcttgaa
caaataaaaaaagggaaatttgtagcagttgttggaggtgatcactcttgtcctcttgga
cttatcaaagctttaagtgatactcaaaaagagtcttttgggattttacatgttgatgct
caccacgatttaagagaagcttatgaaggttttacttactctcacgcttcaattttttat
aacgttatgaaagaatgtgaaaaagtttcaaatctagttcaagttggtattcgtgattat
agtaaagaagaagcaactagaatgattaattatggttcaaaaggtgcctgtttatatgat
actttaatgcaatcagaacttgctagtggaaaatcgcttgaagaggtttttgcaccatat
ataaatcaacttccacaaaatgtttatttatcaatagatattgatggattagagccatta
aactgtccaaatacaggaactccagttccaggaggattaagatatggagagcttgagcat
ctaatatttatggttgtaaaagctggtaaaaatatcataggatttgacctttgtgaagtt
ggcgatagtgctgatggttgggatgcaaatgttggctcaagagttttataccaattatgt
ggtgcattacttgcaagtcaagggaaaatagaatacaaataa

DBGET integrated database retrieval system