KEGG   Arcobacter butzleri RM4018: Abu_1773Help
Entry
Abu_1773          CDS       T00600                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
abu  Arcobacter butzleri RM4018
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Abu_1773 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Abu_1773 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Abu_1773 (trpA)
Enzymes [BR:abu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Abu_1773 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1773769..1774509)
Genome map
AA seq 246 aa AA seqDB search
MKKLVGYITASLPNNSFTVDLAFALKESGVDILELGVPFSDPVADGPVIEKANLKALNNG
FKLKDLFEISSKIGHDIDTLWMGYMNPFFHYGVENFLKKAQEHGVNGTIIPDLPYEMAQR
FEPLFEKYEKANITFIAPTDSEDRVKLLVENSKKFIYMVAYTGITGSGQKEDLSLLINNV
RKYTNTPLYIGFGVDEKSCKEKAVGVDGVIVGSAFVKHLIDDSLSNSEKIKKISLVAKEI
KEKINE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaattagtaggttatattacggcatctcttccaaataatagttttacagttgat
ttggcctttgctttaaaagaatctggagttgatattttagaattaggagttccattttca
gatcccgttgctgatggaccagttattgaaaaagcaaatttaaaagctttaaataatggt
tttaaattaaaagatttatttgaaatatcttcaaaaattggacacgatattgatacttta
tggatgggatatatgaatcctttctttcattatggtgttgaaaactttttaaaaaaagca
caagaacatggagttaatggaacaataattccagacttaccatatgaaatggctcaaaga
tttgagccattatttgaaaaatatgaaaaagcaaatattacttttattgcaccaacagat
agtgaagatagagtaaaacttttagtagaaaactcaaaaaaatttatttatatggtagca
tatactggaattacaggaagtgggcaaaaagaagatttgtctttgcttataaataatgtt
agaaaatatacaaacacacctttatatattggctttggtgttgatgaaaaaagttgtaaa
gaaaaagctgttggtgtagatggtgtaattgttggaagtgcatttgttaaacatttaatt
gatgatagtttatcaaatagtgaaaaaattaaaaaaatttctcttgttgcaaaagagata
aaagaaaaaattaacgaataa

DBGET integrated database retrieval system