KEGG   Arcobacter butzleri RM4018: Abu_2134Help
Entry
Abu_2134          CDS       T00600                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
abu  Arcobacter butzleri RM4018
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:abu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Abu_2134 (tpiA)
   01230 Biosynthesis of amino acids
    Abu_2134 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Abu_2134 (tpiA)
   00051 Fructose and mannose metabolism
    Abu_2134 (tpiA)
   00562 Inositol phosphate metabolism
    Abu_2134 (tpiA)
Enzymes [BR:abu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Abu_2134 (tpiA)
Exosome [BR:abu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Abu_2134 (tpiA)
  Exosomal proteins of bladder cancer cells
   Abu_2134 (tpiA)
  Exosomal proteins of melanoma cells
   Abu_2134 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2126477..2127187
Genome map
AA seq 236 aa AA seqDB search
MPIIASNFKTNHTRKSTTLFVNEVNNFLEKNKISNEVYIFPTSTSLDHFETVPNLMIGVQ
NAYPTTSGSFTGEIGTFQLNEFEIKTILIGHSERRHILGETQETITKKYEFYKNLGYKII
YCIGEPLEIKKQGIEKTLEYIYEQFIGIDVNYSNLILAYEPVWAIGTGVTATIDDIKNVH
NAIKQKINKPLLYGGSVKVENVREICQIENVDGALIGTASWKVEDFIEILENTKDL
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcctataattgcaagtaatttcaaaactaatcatacaagaaaatcaactactttattt
gtaaatgaagtaaataattttttggaaaagaataaaatttctaatgaagtttatattttt
ccaacatcaacttcgttggatcattttgagactgttcctaatcttatgattggagtacaa
aatgcttatccaacgacaagtggctcatttactggagaaataggaacttttcaattaaat
gaatttgaaattaaaacaattttaataggtcatagtgaaagaagacatatcttaggcgaa
actcaagaaacaattacaaaaaaatatgagttttacaaaaatttaggatataaaatcatt
tattgtataggtgaacctttagagataaaaaaacaaggtattgaaaaaactttagaatat
atttatgaacaatttattggaattgatgtaaattactctaatttgatacttgcttatgaa
ccagtttgggctattggtacaggagttactgctacaatagatgatataaaaaatgttcac
aatgcaataaaacaaaaaattaataaaccacttttatatggtggtagtgttaaagtagaa
aatgtaagagaaatctgccaaatagaaaatgttgatggtgctttaattggaactgcttca
tggaaagttgaagattttatagaaattttagaaaatacaaaggatttataa

DBGET integrated database retrieval system