KEGG   Arcobacter butzleri RM4018: Abu_2134Help
Entry
Abu_2134          CDS       T00600                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
abu  Arcobacter butzleri RM4018
Pathway
abu00010  Glycolysis / Gluconeogenesis
abu00051  Fructose and mannose metabolism
abu00562  Inositol phosphate metabolism
abu01100  Metabolic pathways
abu01110  Biosynthesis of secondary metabolites
abu01120  Microbial metabolism in diverse environments
abu01130  Biosynthesis of antibiotics
abu01200  Carbon metabolism
abu01230  Biosynthesis of amino acids
Module
abu_M00002  Glycolysis, core module involving three-carbon compounds
abu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:abu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Abu_2134 (tpiA)
   00051 Fructose and mannose metabolism
    Abu_2134 (tpiA)
   00562 Inositol phosphate metabolism
    Abu_2134 (tpiA)
Enzymes [BR:abu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Abu_2134 (tpiA)
Exosome [BR:abu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Abu_2134 (tpiA)
  Exosomal proteins of bladder cancer cells
   Abu_2134 (tpiA)
  Exosomal proteins of melanoma cells
   Abu_2134 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABV68348
UniProt: A8EWM5
Position
2126477..2127187
Genome map
AA seq 236 aa AA seqDB search
MPIIASNFKTNHTRKSTTLFVNEVNNFLEKNKISNEVYIFPTSTSLDHFETVPNLMIGVQ
NAYPTTSGSFTGEIGTFQLNEFEIKTILIGHSERRHILGETQETITKKYEFYKNLGYKII
YCIGEPLEIKKQGIEKTLEYIYEQFIGIDVNYSNLILAYEPVWAIGTGVTATIDDIKNVH
NAIKQKINKPLLYGGSVKVENVREICQIENVDGALIGTASWKVEDFIEILENTKDL
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcctataattgcaagtaatttcaaaactaatcatacaagaaaatcaactactttattt
gtaaatgaagtaaataattttttggaaaagaataaaatttctaatgaagtttatattttt
ccaacatcaacttcgttggatcattttgagactgttcctaatcttatgattggagtacaa
aatgcttatccaacgacaagtggctcatttactggagaaataggaacttttcaattaaat
gaatttgaaattaaaacaattttaataggtcatagtgaaagaagacatatcttaggcgaa
actcaagaaacaattacaaaaaaatatgagttttacaaaaatttaggatataaaatcatt
tattgtataggtgaacctttagagataaaaaaacaaggtattgaaaaaactttagaatat
atttatgaacaatttattggaattgatgtaaattactctaatttgatacttgcttatgaa
ccagtttgggctattggtacaggagttactgctacaatagatgatataaaaaatgttcac
aatgcaataaaacaaaaaattaataaaccacttttatatggtggtagtgttaaagtagaa
aatgtaagagaaatctgccaaatagaaaatgttgatggtgctttaattggaactgcttca
tggaaagttgaagattttatagaaattttagaaaatacaaaggatttataa

DBGET integrated database retrieval system