KEGG   Arcobacter butzleri RM4018: Abu_2140Help
Entry
Abu_2140          CDS       T00600                                 

Definition
cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
abu  Arcobacter butzleri RM4018
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2133488..2134507
Genome map
AA seq 339 aa AA seqDB search
MKLAITLSILLGASSLFATSLVQKAKDSGLEAIPAQKAQLMKLIDDPKDPITREKVDLGK
KLYFDPRLSKSGIISCNTCHNLGLGGADGIPVAIGHGWTANPHHLNSPTVYNSVFFKAQF
WDGRSPHLADQAQGPIQAGPEMAAPPALVEQRINSIPEYVAEFKKAYGNDVKIDFEKITS
SIATFEKTLVTPSKFDEFLNGNTKALSNEEKEGLNLFIDKGCVSCHNGIALGGTMQPFEV
ASKYKFTNVGDFKGDANGMVKAPTLRNITETAPYFHNGQIWSLNEAVKEMGSIQLGIDIS
DNDAAKIVTFLKTLKGKKPAISYPQLPESTLDTEKPSFN
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagcaatcacgttatcaatattattaggtgcaagttctttatttgcaacttca
ttggtacaaaaagcaaaagatagtggtttagaagcaattcctgctcaaaaagcacaattg
atgaaattaattgatgatccaaaagatccaatcacaagagaaaaagtagatttagggaaa
aaattatactttgatccaagactttcaaaaagtggaattatttcatgtaatacatgtcat
aacttaggtttaggtggagcagatggaattcctgttgcaataggtcatggttggacagca
aatccacaccatttaaactctccaacagtttataactcagtatttttcaaagcacaattt
tgggatggaagaagtcctcatttagcagatcaagcacaaggtccaattcaagcaggtcca
gaaatggctgcacctccagcacttgttgaacaaagaatcaactctattccagaatacgtt
gctgaatttaaaaaagcttatggaaatgatgtaaaaattgattttgaaaaaatcacttca
tctattgcaacttttgaaaaaactttagttactccttcaaaatttgatgaattcttaaat
ggaaatacaaaagctttatcaaatgaagaaaaagaaggattaaatttatttatagataaa
ggttgtgtaagttgtcacaatggtatagctttaggtggaacgatgcaaccatttgaagtt
gcttcaaaatataaatttacaaatgttggagattttaaaggtgatgcaaatggtatggtt
aaagctccaactttaagaaatataacagaaacagcaccatatttccataatggacaaatt
tggtcacttaacgaagcagtaaaagagatgggttcaattcaattaggtattgatatttct
gataatgatgcagcaaaaattgtaacatttttgaaaacattaaaaggtaaaaaaccagca
atctcttatccacaacttccagaatcaactcttgatactgaaaagccatcatttaactaa

DBGET integrated database retrieval system