KEGG   Arcobacter butzleri RM4018: Abu_2331Help
Entry
Abu_2331          CDS       T00600                                 

Gene name
glsA
Definition
glutaminase A (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
abu  Arcobacter butzleri RM4018
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:abu00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:abu00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:abu00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2337847..2338764
Genome map
AA seq 305 aa AA seqDB search
MNYQTILEEIEKEIQALFVEGKVASYIPALANVNPNQFSMAIKMFDGQTFGVGEIDKKFS
IQSISKVFTFTLALNYYGKELYKRVSHEPSGNPFNSLVQLEYENGIPRNPFINAGAIVTA
DTLVSIYKNDTFNQILDFIKMVSNDKTIDFNEEIFHSELEHGFRNYALINMIKSFGNIHN
DIDEVIKTYFKQCSIMMSPSQLASSMLFLANHGINPITNERILTESKAKRISSLMLTCGH
YDASGDFAYKVGLPGKSGVGGGIVAIVPKKMAICVYSPKLNTQGNSLIGTKALELFTTKT
GLSIF
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaattatcaaactattttagaagagattgaaaaagagattcaagctctttttgttgaa
ggaaaagttgctagttatattccagctcttgcaaatgtaaatcctaatcaattttctatg
gcaatcaaaatgtttgatggtcaaacttttggagttggagagatagataaaaaattctcc
atacaaagcatttcaaaagtttttacatttacattggctttaaactattatggaaaagag
ttatataaaagagttagtcatgaaccatcgggaaatccttttaattcactagttcaactt
gaatatgaaaatggaattccaagaaatccatttataaatgctggtgcgatagtaacagct
gatactttggtttctatttataaaaatgacacttttaatcaaatcttagattttattaaa
atggtttcaaatgataaaaccatagattttaatgaagagatttttcactctgagctagaa
catggattcagaaactacgcgctaataaatatgattaaaagttttggaaatattcacaat
gatattgacgaagttataaaaacatattttaaacaatgttctattatgatgagcccgtct
caacttgcaagttcaatgctttttttggcaaatcatggaataaatccaataacaaatgaa
agaattctcactgaatcaaaagcaaaaagaataagttcacttatgcttacttgcggtcat
tatgatgcaagtggagattttgcttataaagttggacttcctggaaaaagcggtgttgga
ggaggaattgtcgcaattgttcctaaaaaaatggcaatttgtgtatattctccaaaacta
aatactcaaggaaattcactaattggaacaaaagctctagaattatttactacaaaaact
ggtctatcaattttttaa

DBGET integrated database retrieval system