KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT116880Help
Entry
AGABI2DRAFT116880 CDS       T03140                                 

Gene name
AGABI2DRAFT_116880
Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
abv00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:abv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AGABI2DRAFT116880 (AGABI2DRAFT_116880)
Enzymes [BR:abv01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     AGABI2DRAFT116880 (AGABI2DRAFT_116880)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 18076890
NCBI-ProteinID: XP_006459921
JGI: Agabi_varbisH97_2_116880
Position
Unknown
AA seq 353 aa AA seqDB search
MLRLVIQSRIPCRLSPRLPLCRHASTQRLSARKDWKLPVAGGVFIGLASLYFFLPDPSRS
APTSANKPLSASHFTPATVISNEISGPNSKILKLRVPPHLVIRDENDPIGFGPIWSVFIK
DDDIQVERPYTPLESIDENGNMVFWIKRYPKGEVGRWLHSKQVGDTVELRGPLRTWPWDE
DKWDEIVLISGGTGITPFYQLLRQVFDHSTIIPQNTSFTLIHCSRTPEEMPPGQILGPLA
AYAEKYPNKLRLKLLVDTDDGSQPTTSLPLEVGRVNEQHIKNSLGFSEPTRWQKLFGRKD
TRPPIPAKTLFLVCGPDQMVAAVSGPYGRNLSQGPTLGVLGRLGATSKQVWKL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcttagactcgtgattcaaagtcgaataccgtgtcgactctctccaagacttccgctt
tgtcgccacgcatcgacacaaaggctttctgcgcggaaagactggaagttacccgttgca
gggggtgttttcatcggtcttgcctcgctttatttttttctcccggacccgtctcgaagc
gcaccaacctctgcgaacaaacccctctcggcaagccacttcacgcccgcaaccgttatt
tccaatgagatatccggtcccaattcaaagatactcaaactccgcgtacctccacacctc
gtgattagagacgaaaatgacccaataggatttggacctatctggtccgtcttcataaaa
gacgatgacatacaagtagaaaggccatatacaccgctggaaagcatagatgaaaacgga
aatatggttttttggataaagaggtacccaaaaggggaagtaggacggtggttgcattcg
aagcaagtcggtgatactgttgagcttcgaggcccattgagaacatggccttgggatgag
gacaaatgggatgaaattgttttaatttccggcggcacaggaatcacacctttctaccaa
ctccttcgtcaagtgttcgaccactcaacaatcataccacaaaacacttcttttaccttg
atacattgttcacgaactcccgaagaaatgccaccagggcaaatccttggacctttagca
gcctatgcagaaaaatatccaaacaagcttagactaaagttgttagttgacaccgatgac
ggttcacaaccaacgacttccttacctctagaagtgggacgcgttaacgaacagcatata
aaaaatagtctaggtttttctgagcctacacgctggcaaaaattgtttggtaggaaagat
acacgccctcccatacccgctaaaacgttatttctggtgtgcggtcctgatcaaatggtt
gcggcggtgtcgggaccgtatggacgaaatttatcgcagggaccaacgcttggggtcctg
ggcaggcttggggcgacatccaagcaagtttggaaactatga

DBGET integrated database retrieval system