KEGG   Agaricus bisporus var. bisporus H97: AGABI2DRAFT182460Help
Entry
AGABI2DRAFT182460 CDS       T03140                                 

Gene name
AGABI2DRAFT_182460
Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
abv  Agaricus bisporus var. bisporus H97
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AGABI2DRAFT182460 (AGABI2DRAFT_182460)
Enzymes [BR:abv01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     AGABI2DRAFT182460 (AGABI2DRAFT_182460)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 292 aa AA seqDB search
MEERRGGTSRGRERGSGKTAGRFGDERGVVGRKRKGKSFSQRKALDPTKWLEFPLKEKIQ
VSPNTAIYRFKLPGMLDVLGLPIGQHVSVSADINGKLVARSYTPVSSDNDPGCFDLLIKT
YEKGNISRTMDSLKIGDTMRFKGPKGNFIYTPRLCEHINMIAGGTGITPMLQIIRAVLGN
PADPTDINLIYANVNYDDILLREDLDQLSKLHSNRFKVYFVLNNPPPSWDGGVGFVTKDH
IKEHLRNPDDGNGKLLICGPPPMVAAMKKNIQELGYPAPNTISKLQDKVFVF
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggaggagagaagaggtgggacgagcaggggaagggagagaggcagtggaaagacggcg
ggaaggttcggggacgagagaggcgtcgtggggaggaagagaaagggaaagtctttttcc
caacgcaaggccctcgatcccaccaaatggctggaattccccctcaaggagaaaatccag
gtttcccccaacactgccatttaccgtttcaagcttcccggcatgctcgacgttctcggt
cttcctatcggtcaacacgtctccgtctctgcagacatcaacggcaaactcgtagcccgc
agctacacccccgtcagcagcgacaacgaccctggctgtttcgaccttctcatcaagacc
tacgaaaaaggcaatatttcgcgcaccatggattctcttaaaattggcgatactatgcgc
ttcaagggccccaagggcaactttatctatacccctcgtctctgcgaacatataaacatg
attgctggcggaactggtattacccccatgcttcagatcatccgtgctgtcctcggcaac
cccgccgacccgactgatatcaacctcatttacgccaatgtgaactatgatgatatcctt
ctccgggaggatttggaccagctttccaagcttcattccaaccgcttcaaggtctatttc
gtcctcaataaccccccaccttcctgggacggtggcgttggttttgtcaccaaagatcac
attaaagagcacctccgcaaccctgacgatggcaacggcaaactcctcatctgcgggcct
cctcccatggttgccgcgatgaaaaagaatattcaagaactcggttaccccgctcctaat
accattagcaaacttcaagacaaggtctttgttttctaa

DBGET integrated database retrieval system