KEGG   Acinetobacter baumannii 1656-2: ABK1_0022Help
Entry
ABK1_0022         CDS       T01819                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
abx  Acinetobacter baumannii 1656-2
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
23926..24624
Genome map
AA seq 232 aa AA seqDB search
MIKKLGILALFSLTTSLSFANVDTVRENIKKQYPNLKISNIQKTEMPGLYSANLDQQIIY
LGEDGQHMFVGSMIRLKDQKNLTKDLVLGQNSIDWKQLPLKDAIKTVKGNGQHVLAVFSD
PNCPYCKQLEPELDKLKDVTIYTFIYPLKPQSIVVSRQVWCAPNQSYSWKKLIEQGVKPM
VASCTNPIDRNLELGKKLGFNGTPTLIFANGFKLVGARSAEEIQAVWKELGL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaattaggaatattggcgttatttagtttaactacaagtttgagtttcgct
aatgtagatactgttcgggaaaatattaaaaaacaatatcctaatttgaaaattagtaat
attcagaaaaccgaaatgcctgggctatatagtgctaatctggatcagcaaattatttat
cttggtgaagatgggcagcacatgtttgtaggctctatgattcggttaaaagaccagaag
aacttaactaaagatctggttttagggcagaactcaattgattggaaacagttgccttta
aaagatgccattaaaacagtcaaaggtaatggtcagcatgttttagcagtattttctgat
ccaaattgcccttattgtaagcagcttgaacctgaactcgacaagcttaaagatgtcact
atttacacttttatttatcctttaaaacctcagtctattgtggtttctagacaagtttgg
tgtgcaccgaatcaatcatattcatggaaaaaattaattgagcaaggtgttaaaccaatg
gttgcgagctgtacaaacccgattgaccgtaacttggaattagggaaaaaattaggtttt
aatggcacacctactctcatttttgctaacggatttaaactcgtcggagcgcgctctgct
gaagaaattcaggcagtttggaaagagttaggtttataa

DBGET integrated database retrieval system