KEGG   Acinetobacter baumannii 1656-2: ABK1_0100Help
Entry
ABK1_0100         CDS       T01819                                 

Definition
(GenBank) galU
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
abx00040  Pentose and glucuronate interconversions
abx00052  Galactose metabolism
abx00500  Starch and sucrose metabolism
abx00520  Amino sugar and nucleotide sugar metabolism
abx01100  Metabolic pathways
abx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ABK1_0100
   00052 Galactose metabolism
    ABK1_0100
   00500 Starch and sucrose metabolism
    ABK1_0100
   00520 Amino sugar and nucleotide sugar metabolism
    ABK1_0100
Enzymes [BR:abx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ABK1_0100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADX01734
Position
105993..106868
Genome map
AA seq 291 aa AA seqDB search
MIKKAVLPVAGLGTRFLPASKSIPKEMVTVVDRPAIEYVVREAVEAGIEQIILVTHSSKA
SIENYFDRNFELETTLEQKKKFDLLAEITQIVPEHVSVVSVRQPQPLGLGHAVLCAKSVV
GQDDFAVLLPDVLVKDSSGKNDLSRMIARYNSSQAAQIMVEAVPDHLVDQYGIVDVKHSP
NEGESIAMQGIVEKPAVGSAPSNLSVVGRYVLPAKIMQLLENTPKGAGNEIQLTDAIAML
QETDTVEAYRMQGQTFDCGSKIGYLKAVLHYGVEHPKLGNDFKQLIQELKL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaagcagttttaccagtagccggtttaggtacacgttttctaccggcaagt
aagtctattccaaaggaaatggtaacggtcgttgatcgtcctgcaattgaatatgtagta
cgcgaggcggtagaggctggaattgaacaaattattttagttactcattcatcgaaagca
tcaattgaaaattattttgatcgtaactttgagttggaaaccaccctagaacaaaagaaa
aaattcgatttacttgcagagattactcaaattgtgccagagcatgtgagtgtagtaagt
gttagacaacctcagcccttaggcctagggcatgctgttttatgtgcaaagagtgttgtt
ggtcaagatgattttgcagtgctattaccagatgtattagtgaaagatagctctggaaaa
aatgatctatctcgtatgattgctcgctataactcaagccaagctgctcaaatcatggtt
gaggcagtgccagaccatttagtagatcaatatggtattgtggatgtaaaacatagccca
aatgaaggtgaaagcattgctatgcagggtattgttgaaaagcctgcagtaggctctgca
ccatcaaacttatcggtggttggccgctatgtgttacctgccaagattatgcaattactt
gagaacacgccgaaaggtgcgggtaatgaaattcagttaactgatgcaattgcaatgctt
caagaaacagatactgttgaagcttatcgtatgcaaggtcaaacgtttgattgtggtagt
aagattggctatttaaaagctgtactacactatggagttgaacaccctaagttaggaaat
gattttaaacagttaattcaggaacttaaattataa

DBGET integrated database retrieval system