KEGG   Acinetobacter baumannii 1656-2: ABK1_0139Help
Entry
ABK1_0139         CDS       T01819                                 

Definition
Enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ABK1_0139
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ABK1_0139
   00650 Butanoate metabolism
    ABK1_0139
  Lipid metabolism
   00071 Fatty acid degradation
    ABK1_0139
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABK1_0139
   00310 Lysine degradation
    ABK1_0139
   00360 Phenylalanine metabolism
    ABK1_0139
   00380 Tryptophan metabolism
    ABK1_0139
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ABK1_0139
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ABK1_0139
   00281 Geraniol degradation
    ABK1_0139
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABK1_0139
   00627 Aminobenzoate degradation
    ABK1_0139
   00930 Caprolactam degradation
    ABK1_0139
Enzymes [BR:abx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ABK1_0139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
153106..153879
Genome map
AA seq 257 aa AA seqDB search
MQWQSILLEKRNGVGLITLNRPQALNALNSELISEINQALDQLEKDREIGCIVLAGSEKA
FAAGADIKEMADLAFPDIYLDDFFHLADRIAQRRKPLIAAVSGYALGGGCELALMCDFIY
CADNAKFGLPEVTLGVIPGIGGTQRLTHAIGKAKAMEMCLTARQMGAVEAEQSGLVARVF
SKEELLEQTLQAAEKIAARSLTANVMLKETINRAFEVNLTEGLRFERRMFHSIFATTDQK
EGMQAFVEKRQANFKNQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggcaaagtattttattagaaaagcgtaatggggttggattgattacattaaat
cgccctcaagcgctcaatgccttaaatagtgaattaattagcgaaattaatcaggcatta
gatcaactcgaaaaagatcgcgaaattggctgcatcgtattagccggctcagaaaaagct
tttgccgcaggggccgacattaaagaaatggccgatttggcatttcccgatatttattta
gatgacttttttcatcttgcagaccgtattgcacagcgccgtaaacctttaattgctgcg
gtgagtggctatgcattgggtggtggctgtgaattagcactcatgtgtgactttatttat
tgtgctgataacgccaagtttggtttacccgaagtcactttaggggtaattccgggtatt
ggtgggacacaacgattaacccatgccattggtaaagctaaagcaatggaaatgtgcctt
accgctcgtcaaatgggcgcagtagaggcagaacaaagtggtttggttgcacgtgtgttt
agtaaagaagaattacttgaacaaactttacaagccgctgaaaaaatcgcagcacggtct
ttaactgcaaacgtgatgctcaaagaaaccattaaccgagcttttgaggtgaatctcacc
gaaggtttacgttttgaacgtcgcatgttccactccatttttgcaactacggaccaaaaa
gaaggcatgcaggcatttgttgaaaaacggcaggcaaattttaaaaatcagtaa

DBGET integrated database retrieval system