KEGG   Acinetobacter baumannii 1656-2: ABK1_0190Help
Entry
ABK1_0190         CDS       T01819                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ABK1_0190
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ABK1_0190
Enzymes [BR:abx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ABK1_0190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(206858..207403)
Genome map
AA seq 181 aa AA seqDB search
MTQSVYHIPVKAISGETVDLDQYKGKVLLIVNTASKCGLTPQYEGLEKLYQAKKDQGLEI
LGFPANNFKEQEPGSDEEIQQFCSLNYDVHFPLFSKISVAGEDKHPLYQALTTAQPERIG
EGPFRERLEGLGIPTNPAPEVLWNFEKFLVNKNGEVVARFAPNLTADDEQIVKAVEAELA
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgactcaatctgtatatcatattccagtaaaagctatttcaggcgaaacggttgacctt
gaccaatataaagggaaagttttattaatcgtaaacacagcgtctaaatgtggtttaact
ccacaatacgaaggcttagaaaagctgtatcaagcaaagaaagatcaaggtcttgaaatc
ttaggcttccctgcaaacaactttaaagaacaagaacctggttcggatgaagaaattcaa
cagttctgctcattaaactacgatgttcatttcccacttttctctaaaatctctgtagct
ggcgaagataaacatccactttatcaagcgctaacaacagctcaaccagaacgtattgga
gaaggccctttccgtgagcgcttagaaggtttaggtattcctactaaccctgcccctgaa
gtgttatggaatttcgagaaattcctagtaaataaaaacggtgaagttgttgcgcgtttt
gcacctaacttaacagcagacgatgaacaaattgtaaaagcagttgaagcagaattagct
aaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system