KEGG   Acinetobacter baumannii 1656-2: ABK1_0278Help
Entry
ABK1_0278         CDS       T01819                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:abx00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:abx00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:abx03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:abx03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:abx03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(299760..300167)
Genome map
AA seq 135 aa AA seqDB search
MAKVSFYLFETSEERQVDSACRLCRKILLKHSQIWWYCPDVQLQQTLDEKLWSFDPTSFI
AHGVDQVDAAVCISAKQPSEQGWLVFNFNNHALEQVNHFSHIIEIVENNEAAKQIGREKF
KMYRRLGIEPRTFKL
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagttagcttttatctgtttgaaaccagtgaagaacggcaagtcgatagtgct
tgccgtttatgccgaaaaattttactgaagcattcacaaatctggtggtattgcccagat
gtgcagttacaacaaacacttgatgaaaaattgtggagctttgatccgaccagctttatt
gcccatggcgttgatcaggtagatgcggcagtatgtatttcggctaaacaaccttctgaa
caaggttggctggtatttaattttaacaatcatgcacttgaacaagtgaatcattttagc
cacattatagaaattgttgaaaataatgaagcagccaagcaaattggccgagaaaaattt
aaaatgtatcgtcgtttaggtatagaacctcgaacctttaaattataa

DBGET integrated database retrieval system