KEGG   Acinetobacter baumannii 1656-2: ABK1_0373Help
Entry
ABK1_0373         CDS       T01819                                 

Definition
tpiA
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABK1_0373
   01230 Biosynthesis of amino acids
    ABK1_0373
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABK1_0373
   00051 Fructose and mannose metabolism
    ABK1_0373
   00562 Inositol phosphate metabolism
    ABK1_0373
Enzymes [BR:abx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ABK1_0373
Exosome [BR:abx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ABK1_0373
  Exosomal proteins of bladder cancer cells
   ABK1_0373
  Exosomal proteins of melanoma cells
   ABK1_0373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
404146..404940
Genome map
AA seq 264 aa AA seqDB search
MSGSTITPWVVGNWKMNPMRANANQLIEEFKQLLQQNQIADENCHVGVAPVSIALTTVQA
QLQDAARTVYTVAQDVSRVAGTGAYTGEVSAELLKDSQINFVLVGHSERRDIFGDNVEIL
KAKLQNALNAGMTVIYCVGESLEQREQGQAEQVVLQQICDIAPVVTAEQWQNQVVIAYEP
IWAIGTGKTASPQDAQAMHAKIREGLCQLTPAGSNIAILYGGSVKAENAVELAACPDING
ALVGGASLNAASFYQIVQAFAQSK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggttcgacgattacgccttgggtagttggtaactggaaaatgaatccaatgcgt
gccaacgccaaccaacttatagaagaatttaaacaattattgcaacaaaaccaaattgca
gatgaaaactgccatgtgggcgttgcccctgtttctattgctcttacaacggtacaagcg
caattacaggatgctgcaagaacggtatatacggttgcacaggatgtatcacgtgttgct
ggtacaggtgcttatactggtgaagtcagtgcagaactattaaaagatagccaaattaat
ttcgtacttgtaggacactctgaacgtcgtgatatttttggtgacaacgttgaaattttg
aaggcaaaactccaaaatgcattaaatgcgggtatgactgtcatttattgtgtgggcgaa
agccttgaacaacgtgagcaaggtcaggccgagcaagttgttctacagcaaatttgtgat
attgcacctgtagttactgcagaacaatggcaaaaccaagtggttattgcctatgaacct
atttgggcaattggtacaggtaaaacagcttctccgcaagatgcgcaagcgatgcacgct
aaaattcgtgaaggcttatgccaacttacaccagcaggctcaaatattgctattttatat
ggcggtagtgtaaaagctgaaaatgctgttgagttagctgcatgtccagatatcaatggt
gcgttggtgggtggtgcttcattaaatgcagcatctttttatcaaattgtacaagccttc
gcgcaaagcaaataa

DBGET integrated database retrieval system