KEGG   Acinetobacter baumannii 1656-2: ABK1_0397Help
Entry
ABK1_0397         CDS       T01819                                 

Definition
recD
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:abx03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
436868..438619
Genome map
AA seq 583 aa AA seqDB search
MDNLNSPEQSDLSWLTTWSTFLNQAPFTAQTQAPEAAYFLQQLIEASLQGDSCIEISPEQ
IETLGQLVISAEQAKSQVAPCVHDEQGLALYRYWNLEQRLAEQIRRLKQQPIQPVSCEEH
LDLLTDPHQQAALQMVTRQSLSIITGGPGTGKTYTLARIIAVLSQAIPHIRVAMAAPTGK
AAQRMQEALQNSFNDPKLLESGLISAELRNQSTQTIHRLLGMGHSQTPRFNQKQPLPYDV
IVVDEASMLDLNLATLLFEAVPESCRIILLGDANQLASVDVGAVLADLQQIEALSENRVH
LQTSRRFAEGALIGQVARFIQMQTSQINHEQILQKFEIDIVQVSELRSIPLETDMPDVVQ
LEYLPEESPIALETYYQKLMVDFQGYVQSLKAYIQDDRSLEHIENIVRSFDDYRILTAVR
HGPFGLQQLNQYAERWLQQQLGIVTLGGWYVGRPVMMTYNDYQLGISNGDIGLCFEHRTQ
PQQFEVYFPSLNKWVAANRLPKSIQSAFALTIHKSQGSEFTHTAVVLDQAAKNLLSQELI
YTAITRAKKVVSLLVDPEALLQSFTVRTTRKSGLVEKVNRLVR
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
gtggacaatctaaatagccctgaacaaagcgatttaagctggttaacgacttggagtacc
tttctaaatcaagccccgtttactgcacagacacaagctccagaggcagcttattttttg
cagcagctgattgaagcgagcttgcagggtgacagttgtattgagattagcccagagcaa
atagaaacacttggccaactggtgatatctgctgaacaagcaaagtctcaagttgcccct
tgtgtccacgacgagcaggggttggcattataccgatattggaacctagagcaacgtcta
gctgagcaaattcgccgattaaagcaacaaccaattcaacctgtttcatgtgaagagcat
ttagacttattaacagatcctcatcagcaagctgctttgcaaatggtgactcggcagagc
ttaagtattattacaggtgggccgggtacaggtaagacctatacgctcgctcgtattatt
gctgtgcttagtcaggcaattccacatattcgtgtagcgatggctgctccgacgggtaaa
gctgcacagcgtatgcaagaagccttacaaaactcctttaatgacccaaaactgcttgag
tcggggttaataagtgctgagctaagaaaccaaagtacccaaactatccatcgattatta
ggtatggggcatagtcaaactccacggtttaatcaaaaacagcctttgccttatgacgtt
attgtggtggatgaagcctctatgctggacttaaatctggcaacgttattatttgaagcg
gttcctgagtcttgtcgaattattttattaggtgatgccaaccagcttgcttccgtagac
gtcggagctgtacttgcagatttacagcaaatcgaggctttgtctgaaaaccgtgttcac
cttcaaaccagccgtcgttttgcggaaggggctttgattggtcaggttgcccgatttatt
caaatgcaaaccagtcaaatcaaccatgagcaaattttacaaaaatttgaaatcgatatt
gttcaggtttcagagttacgttcaatacctttagaaaccgacatgcccgatgtggttcag
cttgaatatttacccgaagagtcacctatagcgctagaaacttactaccaaaaattgatg
gtggattttcaaggctatgtgcaaagcttaaaagcttatatacaagatgatcgttcactt
gaacatattgaaaatatcgttaggtcattcgatgactaccgtattttaactgccgtacgt
catggaccatttggtttacagcaacttaatcaatatgctgaacgctggttacaacaacag
ctaggtattgtgactttaggaggatggtatgttggccgtccggttatgatgacctataac
gattaccagctcggtatttcaaatggtgacattggtttatgttttgaacatagaacccag
ccgcaacagtttgaagtgtattttccaagtttaaataagtgggttgctgcaaatcggcta
cctaaaagtattcaaagtgcatttgccttaacaattcacaaatcacaaggttctgaattt
acccatacagctgttgttcttgatcaggctgccaagaatttgttaagccaagagttgatc
tacactgcgattacacgagccaaaaaagtagtgagtttattggtcgatccagaggcgtta
cttcaatcttttacagttcgcacgacaagaaaaagcggtttagttgaaaaagttaatcgg
ttagttcgttaa

DBGET integrated database retrieval system