KEGG   Acinetobacter baumannii 1656-2: ABK1_0397Help
Entry
ABK1_0397         CDS       T01819                                 

Definition
recD
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:abx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ABK1_0397
Enzymes [BR:abx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ABK1_0397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
436868..438619
Genome map
AA seq 583 aa AA seqDB search
MDNLNSPEQSDLSWLTTWSTFLNQAPFTAQTQAPEAAYFLQQLIEASLQGDSCIEISPEQ
IETLGQLVISAEQAKSQVAPCVHDEQGLALYRYWNLEQRLAEQIRRLKQQPIQPVSCEEH
LDLLTDPHQQAALQMVTRQSLSIITGGPGTGKTYTLARIIAVLSQAIPHIRVAMAAPTGK
AAQRMQEALQNSFNDPKLLESGLISAELRNQSTQTIHRLLGMGHSQTPRFNQKQPLPYDV
IVVDEASMLDLNLATLLFEAVPESCRIILLGDANQLASVDVGAVLADLQQIEALSENRVH
LQTSRRFAEGALIGQVARFIQMQTSQINHEQILQKFEIDIVQVSELRSIPLETDMPDVVQ
LEYLPEESPIALETYYQKLMVDFQGYVQSLKAYIQDDRSLEHIENIVRSFDDYRILTAVR
HGPFGLQQLNQYAERWLQQQLGIVTLGGWYVGRPVMMTYNDYQLGISNGDIGLCFEHRTQ
PQQFEVYFPSLNKWVAANRLPKSIQSAFALTIHKSQGSEFTHTAVVLDQAAKNLLSQELI
YTAITRAKKVVSLLVDPEALLQSFTVRTTRKSGLVEKVNRLVR
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
gtggacaatctaaatagccctgaacaaagcgatttaagctggttaacgacttggagtacc
tttctaaatcaagccccgtttactgcacagacacaagctccagaggcagcttattttttg
cagcagctgattgaagcgagcttgcagggtgacagttgtattgagattagcccagagcaa
atagaaacacttggccaactggtgatatctgctgaacaagcaaagtctcaagttgcccct
tgtgtccacgacgagcaggggttggcattataccgatattggaacctagagcaacgtcta
gctgagcaaattcgccgattaaagcaacaaccaattcaacctgtttcatgtgaagagcat
ttagacttattaacagatcctcatcagcaagctgctttgcaaatggtgactcggcagagc
ttaagtattattacaggtgggccgggtacaggtaagacctatacgctcgctcgtattatt
gctgtgcttagtcaggcaattccacatattcgtgtagcgatggctgctccgacgggtaaa
gctgcacagcgtatgcaagaagccttacaaaactcctttaatgacccaaaactgcttgag
tcggggttaataagtgctgagctaagaaaccaaagtacccaaactatccatcgattatta
ggtatggggcatagtcaaactccacggtttaatcaaaaacagcctttgccttatgacgtt
attgtggtggatgaagcctctatgctggacttaaatctggcaacgttattatttgaagcg
gttcctgagtcttgtcgaattattttattaggtgatgccaaccagcttgcttccgtagac
gtcggagctgtacttgcagatttacagcaaatcgaggctttgtctgaaaaccgtgttcac
cttcaaaccagccgtcgttttgcggaaggggctttgattggtcaggttgcccgatttatt
caaatgcaaaccagtcaaatcaaccatgagcaaattttacaaaaatttgaaatcgatatt
gttcaggtttcagagttacgttcaatacctttagaaaccgacatgcccgatgtggttcag
cttgaatatttacccgaagagtcacctatagcgctagaaacttactaccaaaaattgatg
gtggattttcaaggctatgtgcaaagcttaaaagcttatatacaagatgatcgttcactt
gaacatattgaaaatatcgttaggtcattcgatgactaccgtattttaactgccgtacgt
catggaccatttggtttacagcaacttaatcaatatgctgaacgctggttacaacaacag
ctaggtattgtgactttaggaggatggtatgttggccgtccggttatgatgacctataac
gattaccagctcggtatttcaaatggtgacattggtttatgttttgaacatagaacccag
ccgcaacagtttgaagtgtattttccaagtttaaataagtgggttgctgcaaatcggcta
cctaaaagtattcaaagtgcatttgccttaacaattcacaaatcacaaggttctgaattt
acccatacagctgttgttcttgatcaggctgccaagaatttgttaagccaagagttgatc
tacactgcgattacacgagccaaaaaagtagtgagtttattggtcgatccagaggcgtta
cttcaatcttttacagttcgcacgacaagaaaaagcggtttagttgaaaaagttaatcgg
ttagttcgttaa

DBGET integrated database retrieval system