KEGG   Acinetobacter baumannii 1656-2: ABK1_0499Help
Entry
ABK1_0499         CDS       T01819                                 

Definition
folA
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ABK1_0499
   00670 One carbon pool by folate
    ABK1_0499
Enzymes [BR:abx01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ABK1_0499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(543122..543631)
Genome map
AA seq 169 aa AA seqDB search
MAWQNVKVVHVVAMDKNHCIGKGNALPWHISADLKHFKEITQGGVVIMGRKTLESMGRAL
PNRVNWVITRDINWHFDGVKIAYSIEDALNAALEDAKNTEKQALFIIGGGEIFKQTLSIA
DRLELTHVDLDVQGDAHYPTIPSEFHKTASEQQVDEKSGTSFEFATYKK
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcatggcaaaatgtaaaagttgtccacgttgtcgcaatggacaaaaatcactgtatt
ggtaaaggcaatgcgttgccatggcatatctctgccgacttaaaacactttaaagaaatc
acacaaggtggtgtggtgatcatgggccgcaaaacgcttgagtctatgggccgtgctcta
ccgaaccgtgtgaactgggtaattacccgtgacattaactggcattttgacggcgtaaaa
attgcgtattcaattgaagatgctttaaatgctgctttagaagatgccaaaaacaccgaa
aagcaagctttattcattattggtggtggtgaaatctttaagcaaaccttgtcaattgca
gaccgtcttgagctcactcatgttgacttagatgtacaaggtgatgcacattatccaaca
ataccgagtgaatttcacaaaactgcaagcgaacagcaagtagatgaaaaatcaggaact
tcattcgaatttgccacttataaaaaataa

DBGET integrated database retrieval system