KEGG   Acinetobacter baumannii 1656-2: ABK1_0534Help
Entry
ABK1_0534         CDS       T01819                                 

Definition
nagZ
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ABK1_0534
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    ABK1_0534
Enzymes [BR:abx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ABK1_0534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(585027..586079)
Genome map
AA seq 350 aa AA seqDB search
MFFNQNSNGTNMIGALMLDIAGTELTQEDIELLQAPQVGGMILFARNIESPQQVRALTDH
MRQVRPDILIAVDQEGGRVQRLKSGFTLLPAMGRFGELYITQPQKALELAEQCGWLMATE
VLAVGIDFSFAPVLDLNAISDVIGDRGFSKNIEDIAPLAGAFMRGMKKAGMANTGKHFPG
HGSVKADSHVAAAIDSRSYDEIYNHDMQSFIKLMPELDALMPAHVIYDQVDPNPAGFSPF
WIQEVLRNRLKFNGVLFSDDLSMQAACVAGGADARIQAALAAGCDMGLVCNDRSAACTAL
DGITNLELPNQERLERMRGRIPQIQVGETLSLGNDWQAVKTAIEEFKNSL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
ttgtttttcaatcaaaattcaaatggaaccaatatgattggcgcgttgatgctggacata
gccggcacagaacttactcaagaagatattgaactattacaagctccgcaagtcggtggc
atgattttatttgcacgaaatattgaatcaccacaacaagtccgtgctttaaccgaccat
atgcgccaagttcgcccagatattttgattgctgtcgaccaagaaggtggtcgcgttcaa
cgtctaaaatctggctttacattattgccagccatgggccgttttggcgagctctatatc
actcaacctcaaaaagcacttgaattagctgaacagtgcggctggttaatggcaactgaa
gttttggctgtggggatcgattttagttttgcgccagttttagatctgaatgcaattagc
gatgtaattggtgaccgtggcttctctaaaaatatcgaagatatcgctccacttgctggt
gcatttatgcgcggtatgaaaaaagccggcatggcaaataccggtaagcacttccctggt
cacggttcggtaaaagccgattcacatgtcgcagccgcaatcgatagccgtagctatgac
gaaatttataaccatgacatgcaaagctttatcaagcttatgcctgagctagatgcgctc
atgcctgcacatgtaatttacgatcaggttgacccaaatccggcaggtttctcacctttc
tggattcaagaagtccttcgtaatcgcttgaagtttaatggcgtacttttctccgatgac
ttaagcatgcaagctgcttgtgtcgctgggggtgcagatgcgcgtattcaagcggctctg
gcagcaggctgtgatatggggttagtgtgtaatgatcgtagtgcagcatgtacagcactc
gatggtattacaaacttagagctaccaaatcaagagcgtttagaacgtatgcgtggtcga
attccacaaatccaagttggtgaaactttatcgcttggaaatgactggcaagctgtcaaa
acagccattgaagagtttaagaattcactctaa

DBGET integrated database retrieval system