KEGG   Acinetobacter baumannii 1656-2: ABK1_0624Help
Entry
ABK1_0624         CDS       T01819                                 

Definition
folK
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:abx00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
676879..677361
Genome map
AA seq 160 aa AA seqDB search
MTVTTYIGLGSNLGDSRQILSEAIAKLKSLGEVKVSKLYQSPPMGPQDQPNYLNAVAQLK
TELLPLDLLDQLQRFEQEAGRVRLRHWGERTLDLDLLIYGNEKIQNERLTVPHVGILQRD
FVVIPLLDLDADLHINDQPLKNLELIQQPTLTVLADESWA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacagtaaccacatatattggcttaggaagtaacctaggtgactcacgccagattctg
tctgaagcgatagccaaacttaaatctcttggtgaagtgaaagtatctaaactttaccaa
agtccccctatgggtccccaagatcagccgaattatctaaatgcagtcgctcagctaaaa
accgagttacttccgcttgacttacttgaccagttacagcgttttgagcaggaagctggg
cgggtaagactccgtcattggggggagcgaactttagatcttgatctactgatttatggc
aatgaaaaaatacaaaatgagcgcttaacggtgccgcatgtaggaatattacaacgagat
tttgttgtgattcctttattagatttagatgctgatctacatattaatgatcagccactt
aaaaatttagaactcatacaacagccaacgctgactgtacttgctgatgagtcttgggct
taa

DBGET integrated database retrieval system