KEGG   Acinetobacter baumannii 1656-2: ABK1_0669Help
Entry
ABK1_0669         CDS       T01819                                 

Definition
hisD
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:abx01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:abx00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
727623..728912
Genome map
AA seq 429 aa AA seqDB search
MRRLSTQDQNFKQVFAELLAFETVNDPNLVQTVDQIIADVRQHGDDHVLKLTQQFDRHPA
HQFSDLELSQQQLKAAFDGLNQEIREALKLAADRIRTFHEAQKQDSWTYVDDLGNTLGQK
VTPLDRVGIYVPGGLASYPSSVLMNAVPAHVAGVPEIIMVVPAPNGELNPLVLAAAYLAG
VSRVFTIGGAQAVAALAYGTQTVPRVDKITGPGNRFVAAAKRAVFGQVGIDMIAGPSEIL
VYAEGVNNAEWLAMDVLSQAEHDTVAQAIFITPDEALLEAVESAIEKHLNELPKAEIART
SIKNRGALVLVKDRAEAVDLINQVAPEHLELCLDDAEAMSQDIRHAGAIFMGRYTPEAIG
DYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSLIMCSKDGVKTLAKTADVLAVQENLDAH
ARSARYRYQ
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgtttatcgactcaagatcagaacttcaaacaggtttttgccgagcttttagct
tttgaaaccgttaatgatcctaatttagttcaaacagtagatcaaattattgctgatgtt
cgtcagcatggtgatgatcatgttttaaaacttactcaacagttcgatcgacatccagcg
catcaattttccgatctagaattgtctcaacaacaacttaaagctgcttttgatggttta
aatcaagagattcgtgaagccctgaaacttgcagctgatcgtattcgtacttttcatgaa
gctcaaaaacaagatagctggacttatgtggatgatttgggtaataccctaggacaaaaa
gtgactccacttgaccgtgttggtatttatgtaccaggcggacttgcatcttatccttca
tctgtacttatgaatgcggtaccagcacatgtggctggtgtacctgaaattattatggtt
gtgccagccccaaatggtgaactaaatccactcgttttagctgccgcctatctagcaggt
gttagccgagtatttaccattggtggggcacaagctgttgctgctttagcttatggtact
caaactgttccacgtgttgataaaattacgggtcctggaaaccgatttgtggcagctgct
aaacgtgctgtatttggtcaggtgggtattgacatgattgctggaccttctgaaatatta
gtttatgcagaaggtgtgaataatgctgaatggttagcgatggatgtattatctcaagct
gaacatgacacagtagctcaagctattttcattactccagatgaagcattattagaagca
gtagagtctgcaattgagaaacatttaaatgaattgcctaaagccgagattgcgcgtaca
tcgattaaaaatcgtggtgcattagttttggtaaaagaccgtgctgaagcagttgattta
attaatcaggttgcaccagagcatttggaactatgtcttgatgatgctgaagcgatgagc
caagatattcgtcatgcaggggcaatttttatgggtcgctatacacctgaagcaattggt
gattattgtgctggcccaaaccacgtattaccgacatcaggcacagctcgtttctcttcg
ccacttggtgtatatgattttcaaaagcgctctagtttgatcatgtgttcaaaagatggc
gttaagactttggctaaaacagctgatgtacttgctgttcaagaaaatctcgatgcccat
gcacgctcggcgcgttatcgttatcaataa

DBGET integrated database retrieval system