KEGG   Acinetobacter baumannii 1656-2: ABK1_0669Help
Entry
ABK1_0669         CDS       T01819                                 

Definition
hisD
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABK1_0669
  Amino acid metabolism
   00340 Histidine metabolism
    ABK1_0669
Enzymes [BR:abx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     ABK1_0669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
727623..728912
Genome map
AA seq 429 aa AA seqDB search
MRRLSTQDQNFKQVFAELLAFETVNDPNLVQTVDQIIADVRQHGDDHVLKLTQQFDRHPA
HQFSDLELSQQQLKAAFDGLNQEIREALKLAADRIRTFHEAQKQDSWTYVDDLGNTLGQK
VTPLDRVGIYVPGGLASYPSSVLMNAVPAHVAGVPEIIMVVPAPNGELNPLVLAAAYLAG
VSRVFTIGGAQAVAALAYGTQTVPRVDKITGPGNRFVAAAKRAVFGQVGIDMIAGPSEIL
VYAEGVNNAEWLAMDVLSQAEHDTVAQAIFITPDEALLEAVESAIEKHLNELPKAEIART
SIKNRGALVLVKDRAEAVDLINQVAPEHLELCLDDAEAMSQDIRHAGAIFMGRYTPEAIG
DYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSLIMCSKDGVKTLAKTADVLAVQENLDAH
ARSARYRYQ
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgtttatcgactcaagatcagaacttcaaacaggtttttgccgagcttttagct
tttgaaaccgttaatgatcctaatttagttcaaacagtagatcaaattattgctgatgtt
cgtcagcatggtgatgatcatgttttaaaacttactcaacagttcgatcgacatccagcg
catcaattttccgatctagaattgtctcaacaacaacttaaagctgcttttgatggttta
aatcaagagattcgtgaagccctgaaacttgcagctgatcgtattcgtacttttcatgaa
gctcaaaaacaagatagctggacttatgtggatgatttgggtaataccctaggacaaaaa
gtgactccacttgaccgtgttggtatttatgtaccaggcggacttgcatcttatccttca
tctgtacttatgaatgcggtaccagcacatgtggctggtgtacctgaaattattatggtt
gtgccagccccaaatggtgaactaaatccactcgttttagctgccgcctatctagcaggt
gttagccgagtatttaccattggtggggcacaagctgttgctgctttagcttatggtact
caaactgttccacgtgttgataaaattacgggtcctggaaaccgatttgtggcagctgct
aaacgtgctgtatttggtcaggtgggtattgacatgattgctggaccttctgaaatatta
gtttatgcagaaggtgtgaataatgctgaatggttagcgatggatgtattatctcaagct
gaacatgacacagtagctcaagctattttcattactccagatgaagcattattagaagca
gtagagtctgcaattgagaaacatttaaatgaattgcctaaagccgagattgcgcgtaca
tcgattaaaaatcgtggtgcattagttttggtaaaagaccgtgctgaagcagttgattta
attaatcaggttgcaccagagcatttggaactatgtcttgatgatgctgaagcgatgagc
caagatattcgtcatgcaggggcaatttttatgggtcgctatacacctgaagcaattggt
gattattgtgctggcccaaaccacgtattaccgacatcaggcacagctcgtttctcttcg
ccacttggtgtatatgattttcaaaagcgctctagtttgatcatgtgttcaaaagatggc
gttaagactttggctaaaacagctgatgtacttgctgttcaagaaaatctcgatgcccat
gcacgctcggcgcgttatcgttatcaataa

DBGET integrated database retrieval system