KEGG   Acinetobacter baumannii 1656-2: ABK1_0875Help
Entry
ABK1_0875         CDS       T01819                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABK1_0875
   00030 Pentose phosphate pathway
    ABK1_0875
   00051 Fructose and mannose metabolism
    ABK1_0875
   00052 Galactose metabolism
    ABK1_0875
   00500 Starch and sucrose metabolism
    ABK1_0875
   00520 Amino sugar and nucleotide sugar metabolism
    ABK1_0875
  Nucleotide metabolism
   00230 Purine metabolism
    ABK1_0875
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ABK1_0875
Enzymes [BR:abx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     ABK1_0875
    5.4.2.8  phosphomannomutase
     ABK1_0875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
964091..965509
Genome map
AA seq 472 aa AA seqDB search
MNVRHSFPKNIFRAYDIRGKLSYLTTDVVRSIAYGLAQQYKQAEQTQLIIGYDARLTSPA
YAHLIEEILVEQGLNVTNIGCCSTPMMYYIAREFGGNGIMVTASHNPKSDNGIKWILRGE
PPSPEMIQQVGEFAQTYVPTHTISLLELSTPQFNSEFCKKYQQAIFNDIQLKRPLKVVLD
GLHGSAGHCSKLVLEKMGCEVIALRTTPNGEFPDHAPDPSHAAHLKELRKTIIEQGADIG
IALDGDGDRVVLLDEKANILTADRLLSLFAQMCLEQQPDKEIVFDVKCSLMVQRTVERLG
GKPKMIRTGSSFLRAYLSQSNGNAIFGGEYAGHYVFNDGRGFGYDDGLYAALRVMEYFTE
SSAATISDLFSNYPERCCTEDTYIGTHQSDPKHVLQDIEILSHRLGARISKIDGVRLDFD
DGFGIIRASNTGEYFTVRFDADNPLRLKEIQQKFIDMLQERYPQIAQELSEA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaagacactcatttccaaaaaatattttccgtgcttacgatattagaggcaaa
ctttcttatttaactacggacgtcgtccgttcaattgcctatggattggcacaacaatat
aaacaagcagaacaaactcaactgattattggttatgatgcgcgcctaacgagtccggct
tatgcgcatttaatcgaagagatattagtagagcagggtttaaatgttacaaatattggt
tgttgctcaaccccgatgatgtactacattgcacgggagtttggtggtaatggcataatg
gtaacagctagccataaccctaaatcagataatggtattaaatggattttaagaggtgaa
cctccatctcctgaaatgatccagcaagtaggtgaatttgcgcaaacttatgtacctact
catacaatttcattattagaattatcaactcctcaatttaattcagaattttgtaaaaaa
taccaacaagcaatctttaacgatattcaactcaagcgccctttaaaagttgtattagat
ggcctacatggatcggcagggcattgctcaaaactcgtacttgaaaaaatgggttgtgaa
gtcattgctttacgtacgactccaaatggtgagttccctgatcatgcaccagacccttca
catgctgcgcatttaaaagaactacgtaaaacgattattgaacagggggcagatattggt
attgcccttgatggtgatggcgaccgtgtcgtattgcttgatgaaaaagccaatatactt
actgctgaccgtttattgtcactatttgcacaaatgtgtctggagcagcaaccagacaaa
gaaattgtatttgatgtgaaatgctcgctcatggttcaaagaaccgtagagcgacttggt
ggtaaacccaaaatgattcgcacgggaagtagcttcctgcgcgcgtatttatcccaatca
aatggtaacgctatttttgggggcgaatacgcgggtcattatgtatttaatgatgggcgt
ggttttgggtatgatgatggtttgtacgctgcattacgtgtaatggaatatttcaccgag
tcgagtgcggcaacaatttctgatttattttctaattatcctgaaagatgctgtaccgaa
gatacttatattggcacccatcagtccgaccctaaacatgtactacaagatattgaaatt
ttaagccatcgtttgggtgctcgaattagtaaaattgatggcgtacgtcttgattttgat
gatggttttggcattattcgagcatcaaatacaggtgagtattttaccgtaagatttgac
gctgataatcctttacgtttaaaggaaatccagcaaaaatttattgatatgttgcaagag
cgttatccgcaaattgcacaagaactttctgaggcctaa

DBGET integrated database retrieval system