KEGG   Acinetobacter baumannii 1656-2: ABK1_0950Help
Entry
ABK1_0950         CDS       T01819                                 

Definition
galactose mutarotase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABK1_0950
   00052 Galactose metabolism
    ABK1_0950
Enzymes [BR:abx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     ABK1_0950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1050516..1051661)
Genome map
AA seq 381 aa AA seqDB search
MKKLAILGVTVYSFAQLANAATLNVKPYGTTQDGQKVDLYTMSNNNGVSVSFISFGGVIT
QILTPDAQGKQNNIVLGFDDLKGYEVTDTKEGIHFGGLIGRYANRIGNAKFSLDGKTYNL
EKNNGPNSLHSGNPGFDKRVWQVKPLISKGETVKASLKLTSPNGDQGFPGKLDVEVIYSL
SDQNEFKIEYKAKTDQPTVVNLTNHSYFNLSGAGNNPYGVLDHVVQLNADRILVTDQNSL
PTGEIASVAGTPFDFRTPKAIVKDIRANNQQLAYGYGYDQTWVINQKSQGKLNLAAIVVD
PKSKRTMQVLTTEPSVQMYTANHLLGNIVGANGVLYRQADALALETQHFPDSPNQPAFPS
TRLNPNQTYNSVTVFKFGVQK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattagcaattttaggtgttacggtttatagctttgcacaactggcaaatgca
gcaacgttaaatgtaaaaccatatggtacgactcaagacggccaaaaagttgatctatac
accatgagtaataacaatggagtctcggtatcttttattagttttggtggtgtaattaca
caaatcttgactcccgatgcccaaggcaaacaaaataatattgttttgggctttgatgac
ctaaaaggctatgaagtcactgataccaaggaaggcattcattttggtggattaattggt
cgttatgcgaaccggattggtaatgctaaatttagcttagatgggaaaacgtataatctt
gaaaaaaataatggcccgaactcattacatagcggcaatcctggttttgataaacgtgtt
tggcaagttaaacccctcatttctaaaggtgaaactgttaaagcttctctgaagttaacc
agtccaaatggagatcaaggttttcctggaaaattagatgtagaagtgatttacagtctt
tcagatcaaaatgaattcaagattgaatataaagccaaaactgatcagcctacagtcgtc
aaccttaccaaccacagttatttcaacttatcaggcgctgggaacaatccttatggcgtg
ctagatcatgtggtacaactcaatgcagaccgtatattggtaactgatcaaaactcttta
ccaacaggtgaaattgcttcagttgcaggtacaccttttgattttcgaacgcctaaagca
atcgtaaaagatattcgagcaaataatcagcaattggcctatggatatggctatgaccaa
acttgggtaattaatcaaaagtctcaagggaaactcaatcttgcagctattgtggttgac
ccaaaatctaaacggaccatgcaagtcttaaccactgaaccaagtgtccaaatgtataca
gccaatcatttattaggaaatattgttggcgcaaatggcgtactctatcgacaagcagac
gcactagcattagaaacacagcattttccagacagcccgaatcaaccggctttcccgtct
acacgtttaaacccaaatcaaacttataacagtgttaccgtatttaagtttggtgttcaa
aaatag

DBGET integrated database retrieval system