KEGG   Acinetobacter baumannii 1656-2: ABK1_0971Help
Entry
ABK1_0971         CDS       T01819                                 

Definition
tesA
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ABK1_0971
Enzymes [BR:abx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ABK1_0971
   3.1.2  Thioester hydrolases
    3.1.2.-  
     ABK1_0971
Lipid biosynthesis proteins [BR:abx01004]
 Fatty acid synthase
  Component type
   ABK1_0971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1076852..1077421)
Genome map
AA seq 189 aa AA seqDB search
MLPMFVSAKTILILGDSISAGYGIDPKQGWVQLLQKRLDQQYPKQHKVVNASVSGETTSG
ALARLPKLLQTYKPEVVVIELGGNDGLRGQPPQMIQKNLSQLIQLSQKQKAKVILFGMKI
PPNYGTAYSKAFENSYKTVSQKYQVKLLPFFLDGVAGQKQLMQNDLIHPNTQAQSKLLNL
AYPYIKGAL
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgttgcccatgttcgtctcggcaaaaactattttaattttaggagatagtattagtgcc
ggttatggaatagaccctaaacaaggttgggtacaattactacaaaaacgtttagaccaa
cagtatcccaaacaacataaagtggtcaatgcaagtgtgagtggggaaaccactagtggc
gctttggcacgattaccaaaacttttacaaacgtataaacccgaggtagttgttattgaa
ttaggcgggaatgatggcttacgtggtcaaccaccacaaatgattcaaaaaaatctgtct
cagctcattcaattaagccagaagcaaaaagccaaggttattctttttggtatgaagatt
ccgcccaattatggcacggcttatagcaaagcattcgaaaatagctacaaaactgtaagt
caaaaatatcaggtgaaattgctaccgttttttcttgatggcgtcgctgggcaaaagcaa
ctaatgcaaaatgacttgattcatccaaatacccaagcacaatcaaaattactgaattta
gcttacccatacataaaaggtgccctatag

DBGET integrated database retrieval system