KEGG   Acinetobacter baumannii 1656-2: ABK1_1342Help
Entry
ABK1_1342         CDS       T01819                                 

Definition
(GenBank) Putative acetyl-CoA synthetase/AMP-(Fatty) acid ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
abx00010  Glycolysis / Gluconeogenesis
abx00620  Pyruvate metabolism
abx00640  Propanoate metabolism
abx00680  Methane metabolism
abx01100  Metabolic pathways
abx01110  Biosynthesis of secondary metabolites
abx01120  Microbial metabolism in diverse environments
abx01130  Biosynthesis of antibiotics
abx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABK1_1342
   00620 Pyruvate metabolism
    ABK1_1342
   00640 Propanoate metabolism
    ABK1_1342
  Energy metabolism
   00680 Methane metabolism
    ABK1_1342
Enzymes [BR:abx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ABK1_1342
Lipid biosynthesis proteins [BR:abx01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ABK1_1342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADX02976
Position
1451836..1453479
Genome map
AA seq 547 aa AA seqDB search
MKTLAEAYQQFDLTRLIEEQLVGHPQAINAYVECCERYVGKYKTALIWEGKNGQAEHYTF
EQLAELSGKLANFFKAQGIQAGDCIAGLLPRTPELLITILATWRIGAIYQPLFTAFEAKS
IDHRITTAQTKLIVTNDEQRPKLNTLNVPVIVTVHQTGLLSEHDFDFWQSLQRYSEQCEP
VNRSFDDDFLMMFTSGTTGLAKSVPVPLKAILAFKGYMTHAVDLREEDMFWNLADPGWAY
GLYYGITGPLSLGHGIIMDERSFNVDQAIELIKKYKVSNLTGSPTAFRMFFGFKEKFDPS
IKQHLRVVSSAGEPLTPEVVNWFKQDLEVNIFDQYGQTELGMVIANHHALEHPLKVGSAG
FAIPGHRFAVLDQNYQELPTGGVGILAMDSEQSPLMWFKGYGGNNRKAFVGKYYLTGDTV
TLNEHGGIDFVGRADNVITTSGYRVGPFDVESTLLECEAVLESAVIGKPDPERTEIVKAF
VVLKPAYQACETLKDKLQQYVRNRLSRHAYPKEIEFVDSLPKTTSGKIQRGLLKQQEIAK
MQQAYAS
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttggcagaagcttatcagcaatttgatcttacaaggctcatcgaagagcaa
cttgttgggcatccccaagcaataaatgcttatgttgagtgctgtgagcgttatgtagga
aaatataaaacagcgcttatctgggaagggaaaaacggacaggcagagcactatacgttc
gaacaacttgctgaactttctggaaaacttgctaacttctttaaagcacaaggaattcaa
gctggagattgtattgcaggacttctaccaagaacgcctgagttattaattacaattttg
gcaacgtggcgtataggtgctatttatcagcctttatttactgcctttgaagcaaaatcg
attgatcaccgaattacgactgctcaaactaaattgattgtgaccaatgatgaacagcgc
cctaaactgaataccttgaatgttccggttattgtaactgttcatcaaacaggtctttta
tctgagcatgactttgatttttggcaatctttacaacgatattctgagcaatgtgagcca
gtaaatcgtagctttgatgatgactttttaatgatgtttacctcaggcacaactggactt
gcgaagtctgtacctgttccactaaaagcaattttagcatttaaaggttatatgacccat
gccgttgatttgcgtgaagaggatatgttctggaatctggcagatccgggctgggcatat
ggtttgtattatggcattaccgggcctttaagcttgggtcatggcattattatggatgag
cgttcatttaatgtagatcaggcaatagaattaattaaaaaatataaagtaagtaattta
acaggatcgcctacagcatttcgcatgttctttggatttaaggaaaaatttgacccttca
attaaacaacatttacgcgtagtgagcagtgcaggtgagccattaactcctgaggttgtg
aactggtttaagcaggatttagaggtcaatatttttgatcaatatggccaaactgagcta
gggatggtgattgcaaatcatcatgctcttgagcatccattaaaagtaggttcagctggt
tttgcaattcctggacatcgttttgcggtgttagaccaaaattatcaagaattgccaact
ggtggtgttggtattttggcaatggactcggagcaatctccattgatgtggtttaaaggt
tatggtggcaataatcgcaaagcctttgttggcaaatattatttaactggtgacacggtc
actttaaacgaacatgggggcattgattttgtgggacgtgctgacaatgtcattacaact
tcgggctatagagttggaccatttgatgttgaaagtactttgttagagtgtgaggcggta
ttagagtcagcagtaattggtaagccagatccggaacgaaccgaaatagtcaaagctttt
gtggtacttaagcctgcttatcaagcgtgtgaaacattaaaagataagttacagcaatat
gttcgtaaccgtttatctcgtcatgcttatccaaaagagattgagtttgtggacagtcta
ccgaaaaccacgagcggaaaaattcaaagaggactgttgaagcagcaagaaattgcaaaa
atgcagcaagcctacgcaagctaa

DBGET integrated database retrieval system