KEGG   Acinetobacter baumannii 1656-2: ABK1_1347Help
Entry
ABK1_1347         CDS       T01819                                 

Definition
Putative 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ABK1_1347
Enzymes [BR:abx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     ABK1_1347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1456860..1457195
Genome map
AA seq 111 aa AA seqDB search
MQFSSVYQIPCRDGIGDDYWNSACLLKSTLSSEQIESFLKKLESDSGRVRPSHHISLDVD
LIAWGSDLDHMQFNSKKLPLALDVKIPLYELWDCETLKADSTLYPVVNFKV
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
gtgcagttttcatctgtttatcaaattccatgccgagatggtattggagatgattactgg
aactcagcgtgtctattaaaaagcaccttatcatctgaacaaattgaatcttttttaaag
aaacttgagtcagattctgggcgtgttcgaccatcacatcatatttctttagatgtagat
ttgattgcatggggaagtgatctggaccatatgcaatttaattctaaaaaattgccgtta
gcactcgatgtaaaaattcctttatatgaactttgggattgtgaaaccttaaaggctgat
agcacactttatccagtcgttaattttaaagtttaa

DBGET integrated database retrieval system