KEGG   Acinetobacter baumannii 1656-2: ABK1_1625Help
Entry
ABK1_1625         CDS       T01819                                 

Definition
pyrB
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:abx00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:abx00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1723167..1724183
Genome map
AA seq 338 aa AA seqDB search
MHIAALHQPSQVQLNQDGNLKHFLTIEGLSKENLTKILDTAQSFLDDNNNLINRPLLEGR
TVMNLFFENSTRTRTTFEAAAKRLSANVLNIDIARSSTSKGETLRDTLWNLEAMAADIFV
VRHSSSGAAHFIAKDVCPKVAIINAGDGRHAHPTQAMLDMLTIRRETKKPFEDLSVAIIG
DIKHSRVARSDVAALQTLGCKDIRVIAPNTLLPVGFSEYGDHVRLFNNMDEGITGCDVII
ALRIQNERIDSPALSSQSEFYRMYGLNKERLSLAKPDCIVMHPGPMNRGVEIDSSIADGE
QSVILKQVTNGIAVRMAVLALSMQGQLQEQGLIEAIAL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcatattgcagcgttgcatcaaccgagccaggttcagctcaatcaagacggaaattta
aaacattttttaacgattgagggcctttcaaaagaaaacctcactaagattttagatacc
gcgcaaagctttttagatgataataataatttaattaaccgcccgcttttagaaggtcgg
acggttatgaatctcttctttgaaaactccacccgtactcgtactacttttgaagcagca
gcaaaacgtttgtctgccaatgtattgaacattgatattgcacgttcaagcacgtcaaaa
ggtgagactttacgagatacgctttggaacctcgaagcaatggctgccgatatttttgtt
gtacgtcattcatcttcaggtgctgcacatttcattgctaaagatgtatgtccgaaagtc
gcaattattaatgccggagatggacgtcatgcccatccaacgcaagcgatgctcgatatg
ctcactattcgccgtgagacgaaaaaaccatttgaagacttgagtgttgccattattggt
gacattaaacactctcgcgttgcgcgttcagatgtagctgcacttcaaacactcggatgt
aaagatatccgtgtgattgcgccgaacaccttattaccggttggtttttcagaatatggc
gaccatgttcgtttgttcaataacatggatgaaggcattaccggttgtgatgtgattatt
gctttacgtattcaaaatgaacgtatcgattcaccagcattatcttcacaatctgaattt
tacagaatgtacggtttaaacaaagagcgccttagcttggctaaaccggactgtattgtt
atgcatccgggaccaatgaaccgtggtgtagaaattgattcgagtattgctgatggcgaa
cagtcagtgattttaaaacaggtcactaacggtattgcagttcgtatggctgtgctagcg
ttgtctatgcaagggcaactccaagaacaaggtttaattgaagcgattgcgttgtaa

DBGET integrated database retrieval system