KEGG   Acinetobacter baumannii 1656-2: ABK1_1625Help
Entry
ABK1_1625         CDS       T01819                                 

Definition
pyrB
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ABK1_1625
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ABK1_1625
Enzymes [BR:abx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     ABK1_1625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1723167..1724183
Genome map
AA seq 338 aa AA seqDB search
MHIAALHQPSQVQLNQDGNLKHFLTIEGLSKENLTKILDTAQSFLDDNNNLINRPLLEGR
TVMNLFFENSTRTRTTFEAAAKRLSANVLNIDIARSSTSKGETLRDTLWNLEAMAADIFV
VRHSSSGAAHFIAKDVCPKVAIINAGDGRHAHPTQAMLDMLTIRRETKKPFEDLSVAIIG
DIKHSRVARSDVAALQTLGCKDIRVIAPNTLLPVGFSEYGDHVRLFNNMDEGITGCDVII
ALRIQNERIDSPALSSQSEFYRMYGLNKERLSLAKPDCIVMHPGPMNRGVEIDSSIADGE
QSVILKQVTNGIAVRMAVLALSMQGQLQEQGLIEAIAL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcatattgcagcgttgcatcaaccgagccaggttcagctcaatcaagacggaaattta
aaacattttttaacgattgagggcctttcaaaagaaaacctcactaagattttagatacc
gcgcaaagctttttagatgataataataatttaattaaccgcccgcttttagaaggtcgg
acggttatgaatctcttctttgaaaactccacccgtactcgtactacttttgaagcagca
gcaaaacgtttgtctgccaatgtattgaacattgatattgcacgttcaagcacgtcaaaa
ggtgagactttacgagatacgctttggaacctcgaagcaatggctgccgatatttttgtt
gtacgtcattcatcttcaggtgctgcacatttcattgctaaagatgtatgtccgaaagtc
gcaattattaatgccggagatggacgtcatgcccatccaacgcaagcgatgctcgatatg
ctcactattcgccgtgagacgaaaaaaccatttgaagacttgagtgttgccattattggt
gacattaaacactctcgcgttgcgcgttcagatgtagctgcacttcaaacactcggatgt
aaagatatccgtgtgattgcgccgaacaccttattaccggttggtttttcagaatatggc
gaccatgttcgtttgttcaataacatggatgaaggcattaccggttgtgatgtgattatt
gctttacgtattcaaaatgaacgtatcgattcaccagcattatcttcacaatctgaattt
tacagaatgtacggtttaaacaaagagcgccttagcttggctaaaccggactgtattgtt
atgcatccgggaccaatgaaccgtggtgtagaaattgattcgagtattgctgatggcgaa
cagtcagtgattttaaaacaggtcactaacggtattgcagttcgtatggctgtgctagcg
ttgtctatgcaagggcaactccaagaacaaggtttaattgaagcgattgcgttgtaa

DBGET integrated database retrieval system