KEGG   Acinetobacter baumannii 1656-2: ABK1_1963Help
Entry
ABK1_1963         CDS       T01819                                 

Definition
gpo
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ABK1_1963
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ABK1_1963
Enzymes [BR:abx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ABK1_1963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2080509..2080994
Genome map
AA seq 161 aa AA seqDB search
MSNIYQFEAELLEGDIKQFADYKGKVLLIVNTASKCGFTPQFAGLEKLYEKYKDQGLEVL
GFPCNQFGGQDPGSNKEIGTFCQRNYGVKFPMFAKVDVKGPEAHVIFRYLTREAKGILGS
STIKWNFTKFLVGKDGSVLNRYAPTTKPEALEADIEKALAS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacatttatcagtttgaagctgaattgttagagggagatattaaacaattcgct
gattacaaaggtaaagttttattaattgtaaatactgcaagtaaatgtggttttactcca
cagtttgcgggcctcgaaaaactttatgaaaaatataaagaccaaggtttagaagtttta
ggttttccctgcaatcagtttggtgggcaagatcccggaagcaataaagagataggtaca
ttctgccagcgtaactatggagtgaaattccctatgtttgccaaagtagatgtaaaaggt
cctgaagctcatgtgatctttagatatttaacccgtgaagcaaaaggaattttaggaagc
agtactattaaatggaactttaccaagtttttagtgggtaaagatggttcggttttaaat
cgttatgcgccaacaaccaagcctgaagcattggaagctgatattgaaaaagcattagcg
agttaa

DBGET integrated database retrieval system