KEGG   Acinetobacter baumannii 1656-2: ABK1_2086Help
Entry
ABK1_2086         CDS       T01819                                 

Definition
Malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABK1_2086
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABK1_2086
   00630 Glyoxylate and dicarboxylate metabolism
    ABK1_2086
Enzymes [BR:abx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ABK1_2086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2197075..2199240
Genome map
AA seq 721 aa AA seqDB search
MTARIQKGKLAIAKELYDFIENEALPGSGLDSETYWENFEQVVVDLSPKNKALLAKRDEL
QAKIDEWHRNNKFELGAYKAFLTEIGYLLPEVEDFQITTENVDEEIALLAGPQLVVPVRN
ARYCLNAANARWGSLYDALYGFDVISEEGGAEKGKGYNPVRGAKVIEFAKNFLNEIFPLA
QGSHADATKYAIEQNKLVVTLKDGTKTGLAHEAQFVGFNGEEANPSEVVLLSNGLHVIIE
IDANSPIGQTDLAGVKDLTLEAAVTTIQDLEDSVAAVDAEEKVEGYRNWLGLMKGTLQES
IEKNGKTIVRALNKDREIKNLIGGTTKLHGRSLMLLRNVGHLMTNPAILVDGEEIFEGIM
DALVTPLLSIADIRSENENKNSRKGSMYIVKPKMHGPEEVAFAVELFERAEQALGLPAKS
LKIGIMDEERRTSVNLKNCIAAAKDRTIFINTGFMDRTGDEIHTSMEAAPVVRKEAVKTQ
KWIAAYENRNVAIGLKCGLQGKAQIGKGMWPKPDSMKDMLATKAAHPNAGASCAWVPSPT
GAVLHAMHYHQVNVKARQDQLKAEEMLSLDDLLTPPFATDTNWSAEEINNELENNCQGIL
GYVVRWVDLGVGCSKVPDINNVGLMEDRATLRISSQHVANWLRHGIVTREQVEEVLKRMA
KIVDEQNANDPLYKPMAANFETNIAFQAASDLIFKGCEQPSGYTEPLLHAARLKLKGYTG
D
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacgtattcaaaaaggcaagttagcgattgctaaagaactttacgattttatc
gaaaatgaagctttaccaggttctggtttagatagtgaaacttactgggagaactttgag
caagttgttgtcgaccttagtccaaagaataaagcattattggctaagcgtgatgaatta
caagcaaaaattgatgaatggcaccgcaacaataaatttgaattaggtgcttacaaagca
tttttaactgaaattggttatttattaccagaagttgaagacttccaaattactactgaa
aacgtagatgaagaaattgcattgttagcaggcccacaattagtagtacctgtacgtaat
gcacgttattgcttaaatgcagcaaatgcgcgctggggttctttatatgatgcactttac
ggttttgatgtaatttcagaagaaggtggtgcagaaaaaggaaaaggatataaccctgta
cgtggtgcgaaagttattgagtttgctaaaaacttcttaaatgaaattttcccgcttgcg
caaggctcacatgctgatgcaactaaatatgcaatcgagcagaataaactcgttgtgact
ttaaaagatggtactaaaactggcttagctcatgaagctcagtttgtgggtttcaatggt
gaagaagcgaacccttcagaagttgttcttttgagtaatggcctacatgtcattattgaa
attgatgcgaatagcccaattggccaaactgatttagcgggtgttaaagatctaacactt
gaagctgcggttacaacaattcaggatcttgaagactctgtagcagctgttgatgcagaa
gaaaaggttgaaggttatcgtaactggttaggtttgatgaagggcactcttcaagaatct
atcgaaaaaaatggtaaaacaattgttcgcgctttgaacaaagaccgtgaaattaaaaat
ttgatcggtggcacaacaaaacttcatggtcgttcacttatgttacttcgtaacgtaggt
catttaatgacgaatccagcaattttagttgatggcgaagaaattttcgaaggtattatg
gatgcgttggtaacaccattgttgtcaattgctgacatccgtagtgaaaacgaaaataaa
aactctcgtaaagggtctatgtatattgttaaaccaaaaatgcatggtcctgaagaagtt
gcttttgctgttgagttatttgagcgtgctgagcaagccctaggattaccagcgaagtct
ttaaaaatcggtattatggatgaagaacgccgtacatctgtaaacctgaaaaactgtatt
gctgctgctaaagatcgcacaatctttattaacactgggttcatggaccgtacgggtgac
gaaatccatacctctatggaagctgcaccagttgttcgtaaagaagctgttaaaacacaa
aaatggattgctgcttacgaaaatcgtaacgttgcaatcggtttgaaatgtggtttacaa
ggtaaagcacagattggtaaaggcatgtggccaaaaccagatagcatgaaagatatgttg
gcaactaaagctgctcatccaaatgctggtgcttcatgtgcttgggttccatcaccaact
ggtgctgtacttcatgcgatgcattaccaccaagtaaatgtaaaagcacgtcaagatcag
ttaaaagctgaagaaatgttgtcattagatgacttgttaactcctccatttgcaactgat
acaaactggtcagcagaagaaattaataacgaacttgaaaataactgccaaggtatttta
ggttacgttgttcgttgggtggacttaggtgtaggttgttcaaaagttccggatattaac
aatgtgggcttaatggaagaccgtgcaacattacgtatttcttctcaacatgttgccaac
tggttacgtcacggtatcgtgactcgtgaacaagttgaagaagtgcttaaacgcatggca
aaaattgttgatgaacaaaatgcgaatgatccattgtataaaccaatggcagctaacttt
gaaactaatattgctttccaagcagcttcagatcttatctttaaaggttgtgaacagcct
tctggttatactgagccattactacatgcggctcgtttaaaattaaaaggttatacaggt
gactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system