KEGG   Acinetobacter baumannii 1656-2: ABK1_2101Help
Entry
ABK1_2101         CDS       T01819                                 

Definition
cysQ
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ABK1_2101
Enzymes [BR:abx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     ABK1_2101
Transfer RNA biogenesis [BR:abx03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    ABK1_2101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2216929..2217786
Genome map
AA seq 285 aa AA seqDB search
MFITTTRPNDALIEQLLPILEEASQILLQEYQNYSAGYEFTIQEKHDDSPVTQADLKVNR
FLLKHLAEITPELPVLSEESDYSARHAWSSCWMLDPLDGTKEFIHERDEFTINLSLIEGR
ETIFSVIVVPCEQVVYLGYLKDLPFKYSFSQQQWYQYQKTPYSKQAPVQIGLSHSSKNPK
YQKFIEPIEKIRTVIRREAGSAYKFCMMLEGEIDIYPRFHPTSEWDTSSGQGLLESIGGG
LLTLTGKPFEYNQRDTVLNGGFIAFRDQESKKIAFEALAQSGVLD
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtttataacaacaactcgccccaatgatgctttaattgaacagttactaccaatcttg
gaagaagctagccaaatcttattacaagaatatcaaaattattcggctggatatgaattt
acgattcaagaaaaacatgatgattcacctgtaacgcaagcagatttaaaggtaaatcgt
tttttattaaagcatcttgcagaaattacacctgagttaccggttttatcggaagaaagt
gactatagcgctcgccatgcttggtcttcttgctggatgctagatccacttgatggtacg
aaagagtttatacatgagcgagatgagttcacgataaacttgagtttgattgaagggcgt
gaaacgattttttcggtgattgttgtgccatgtgagcaagttgtttatttaggttattta
aaagatttaccttttaaatatagctttagccaacaacaatggtatcaatatcaaaaaaca
ccttattcaaaacaagctcctgtacaaattggtttaagtcatagtagtaaaaatccgaaa
tatcagaaattcattgaacctattgaaaagattcgtaccgtaattcgacgtgaagcaggc
agcgcttataagttttgtatgatgttagaaggagagatcgatatttatcctagatttcat
ccgacatcagaatgggataccagctcaggtcaaggattattagaaagtataggtggaggt
ttactcactctaacaggtaagccctttgaatataaccagcgtgataccgtattaaatggg
ggctttatcgcatttcgtgatcaggaaagcaaaaaaatagcatttgaagctttagctcaa
tcaggtgttttggattga

DBGET integrated database retrieval system