KEGG   Acinetobacter baumannii 1656-2: ABK1_2178Help
Entry
ABK1_2178         CDS       T01819                                 

Definition
recR
Orthology
K06187  
recombination protein RecR
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:abx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ABK1_2178
DNA repair and recombination proteins [BR:abx03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ABK1_2178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2293830..2294426
Genome map
AA seq 198 aa AA seqDB search
MFSDRFEQLVQALRILPSVGPKSAQRMALHLLMKNREGAFALAHALHEASSYIHECSVCH
SLTEHEICDICASTERDDQLLCVVESPADVMAIEQSGSFRGKYHVLGGHLSPLDGIGPEE
IGIPYLIQRLSQGTIEEVILATNATVEGQATAHYLVEATKHLPIHMTRIAQGVPQGGELE
YVDSHTLSQAVHNRMRMK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgtttagtgatagatttgaacaactcgttcaagctttacgtattttgcctagcgttgga
ccgaagtcggcccaacgtatggctttacatcttttgatgaaaaatcgtgaaggtgcattt
gctttagcacatgctctacatgaagcatcaagttatattcatgaatgtagtgtttgccac
tctttaacagagcacgaaatttgtgatatttgcgcttcaacagaaagagatgatcaattg
ctttgtgtagttgagtccccggcagatgttatggcaatcgagcaaagtggtagttttcgt
ggcaaataccatgtgttgggtggacacctttctccattagatggaatcgggccagaagaa
ataggcattccttatctaatccaacggttaagccaaggtacgatcgaagaagtcattttg
gcaactaatgctactgtggaaggtcaggcgacagcgcattatttggttgaagcgacgaag
catttacctattcacatgacacgtattgcgcaaggcgtaccacaaggtggcgagcttgaa
tatgtggatagtcataccttaagtcaggctgttcataaccgtatgcgtatgaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system