KEGG   Acinetobacter baumannii 1656-2: ABK1_2558Help
Entry
ABK1_2558         CDS       T01819                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:abx00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2696434..2697609)
Genome map
AA seq 391 aa AA seqDB search
MGVTGSIGRSTLKILGQHPDKYSVFAVSAHSRISELVEICKQFRPKVVVVPEQKIVELKT
LFAQQNISDIDVLAGQEGLVDIASHTDVDIVMAAIVGAAGLLPTLAAVKAGKRVLLANKE
ALVMSGEIMMQAARDHQALLLPVDSEHNAIFQSLPHNYLQADRTGQPQLGVSKILLTASG
GPFLNHSLEQLTHVTPQQACKHPNWSMGQKISVDSATLMNKGLELIEACHLFSISEHFVT
VVVHPQSIIHSMVQYVDGSTLAQMGNPDMCTPIAHALAWPERLQTNVPALDLFEYSQLNF
QAPDTQKFPALNLARQAMRAGGLAPTILNAANEIAVEAFLMERIGFTSIPQVVEHTLEKL
ENAAAESIECILDKDKVARSVAQQYISSIGG
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
ttgggtgtaaccggttctattggacgaagtaccttaaaaattttaggtcaacatccagat
aagtattcagtctttgcagtttcggcgcatagtcgaatttctgaacttgttgaaatctgc
aaacagtttcgacctaaagttgttgttgttcctgaacagaaaatagttgaactaaaaaca
ctatttgctcagcaaaatatatcggatattgatgttttagctgggcaagagggtttagtc
gatatcgcatctcatactgatgtggatattgttatggcggcaattgtaggggcagctggg
ctgttgccaactttagcggctgttaaggcaggtaaaagagtactacttgccaacaaagaa
gcattagttatgtctggtgaaatcatgatgcaagctgctcgtgatcatcaggcattgtta
ttgccagttgattcggaacataatgcaattttccaatcattgcctcataattatttacaa
gcagatagaacagggcaaccacagctaggtgtatctaaaatattgcttacagcatctggt
ggtccctttttaaatcactccttagaacaattgactcatgtaacgccgcaacaagcatgt
aaacatccaaactggtcaatgggacaaaaaatttcggttgactcagctactcttatgaat
aaagggttagagttaatagaggcttgtcatttattttcaatatctgaacattttgttaca
gttgttgttcatccacaaagtatcattcactctatggtgcagtatgttgatggttcaaca
ttagcacaaatgggtaacccggatatgtgtactccgattgcacatgcattggcatggcct
gagcgtttacaaactaatgtacctgctttagatttatttgagtattctcaacttaatttt
caggcaccagatacccaaaaatttcctgcattaaatttggctagacaagcaatgcgtgcg
ggaggtttggcaccaaccattttgaatgcagctaatgaaattgcagttgaagcattctta
atggaaaggattggatttacaagtattccgcaagtggtagagcatactttggaaaaatta
gagaatgcagcggctgaaagcatcgagtgcattttagataaagataaagtggctcgatct
gtagctcagcaatatatatcaagtattggaggctga

DBGET integrated database retrieval system