KEGG   Acinetobacter baumannii 1656-2: ABK1_2827Help
Entry
ABK1_2827         CDS       T01819                                 

Definition
proB
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABK1_2827
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ABK1_2827
Enzymes [BR:abx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ABK1_2827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2971035..2972168)
Genome map
AA seq 377 aa AA seqDB search
MIEVVDGQRKLSECKRIVVKIGSSLLTANGQGLDLDAISHWAKQIADLHNAGHEIILVSS
GAVAEGMVRMKLASRPTDLPSLQACAAIGQMGLIHTWSSVLENHSIRTAQVLLTHDDLAD
RRRYLNSCDALQNLIDWRVIPVINENDTVSTDEIRFGDNDTLAAMVAGQVHADLLIILTD
QQGMFDSDPRHNPDAKLLSTVRAMDDVLFEMAGGGGVLGRGGMVTKVRAARLAAKSGCPT
LIASGESDNVLSRVMAGEMLGTLFTTDKDRMTAHQQWLAAHLQTAGRLVIDDGAVEAIKL
KHRSLLPVGVKTVEGHFDRGDVVECVDKQGKRVAVGRVNFSSRSAEIIKGLSSDKVYQVL
GEARSLEMIHRDHMAIY
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagtggtcgatgggcaacgtaagctcagtgagtgtaaacgaatcgttgttaaa
atcggatcatctttactcacggcaaatgggcagggtctagatctggacgctatttcgcat
tgggcgaaacagattgcagatttacacaatgctggacacgaaattattttagtgtcttca
ggagctgtggcagaaggtatggttcgtatgaagcttgcgagtcgacccaccgatctaccc
agtcttcaagcatgcgccgcaattgggcagatgggcctaattcatacttggtctagtgtg
cttgaaaatcatagtatccgaactgctcaggtgttgttaacacatgatgatttggcagac
cgccgtcgttacttaaattcatgtgatgcattgcagaacttgattgattggcgtgttatt
ccggtcattaatgaaaacgatactgtatctaccgatgagattcgttttggtgataacgat
acactagcagctatggttgctggtcaagtacatgctgatttattaattattttaacagat
cagcaaggtatgtttgattcagacccacgtcataatcctgatgcaaagttattatcaact
gtgcgtgccatggatgatgttttatttgaaatggctggtggtggcggtgtgcttggacga
ggtggcatggtcactaaagttcgtgctgcacgtttagctgccaagtcaggttgcccgaca
ttgattgctagtggtgaaagcgacaatgtgttgtcacgagtgatggctggtgagatgctg
ggtacattgtttacgactgataaagaccgtatgacagcgcatcagcaatggcttgctgca
catttacaaacagcgggtcgtcttgtaattgatgatggcgcagttgaagcgattaaattg
aaacatcgcagtttattgcctgttggggtaaaaactgttgaaggacattttgatcgtggt
gatgtggttgaatgtgtcgataaacaaggtaaacgtgttgcggttgggcgagtgaatttt
agctctcgttctgctgaaattattaaaggtctttcttcagacaaagtttatcaagtactt
ggtgaagcccgttcattagaaatgattcatcgcgatcatatggcaatttactaa

DBGET integrated database retrieval system