KEGG   Acinetobacter baumannii 1656-2: ABK1_2882Help
Entry
ABK1_2882         CDS       T01819                                 

Definition
ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:abx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ABK1_2882
Enzymes [BR:abx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ABK1_2882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3023894..3024493
Genome map
AA seq 199 aa AA seqDB search
MIGCLIGEVFALEAPTVLLNVNGVGYEIDTPLSTFCQLQKGQKVTLWTHLVVREDAQQLY
GFSDAQEKTIFRTLLKVNGVGPKMALGILSTLNVELLVHTIEHDDVNTLVKVPGVGKKTA
ERLMIELRDRFKTLAQGTSSAAALPQIQFVSNSPVAEAEAALQSLGYKPLEAQKAVAAVK
ADYTESADIIRAALKSMMK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatcggatgtttaattggcgaagtgtttgccctagaagccccaactgtcttactgaat
gtaaatggtgtgggctatgaaattgatacaccgctttcaacattttgccaattacaaaaa
ggccagaaagttacgctatggacgcatttggtcgttcgtgaagatgctcagcagctttat
ggttttagtgatgctcaagagaaaactattttccgcaccttactaaaagtaaatggtgtg
ggcccgaaaatggcactaggtattctttctacgttaaatgttgaattgctggtacacaca
attgaacatgacgatgtgaatactttggttaaagttccaggtgtaggcaaaaaaacagct
gaacgtttaatgattgaacttcgtgaccgttttaaaactttggcacaaggaacttctagc
gctgcggccctgcctcagattcaatttgtttcgaactcacctgttgcagaagcagaagca
gccttacagtcactaggttataaacctcttgaggcacaaaaagctgttgcggcggttaaa
gccgattacactgaatcagccgatattattcgtgctgcacttaaatcaatgatgaagtaa

DBGET integrated database retrieval system