KEGG   Acinetobacter baumannii 1656-2: ABK1_2969Help
Entry
ABK1_2969         CDS       T01819                                 

Definition
glpK
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    ABK1_2969
Enzymes [BR:abx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     ABK1_2969
Exosome [BR:abx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABK1_2969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3130582..3132090)
Genome map
AA seq 502 aa AA seqDB search
MSNCPKKYIVAFDQGTTSSRAIVLDHDANVVSIAQREFTQIYPQPGWVEHDPMEIWATQS
AVWVEALAQAGIKSEQVAAIGITNQRETTIVWDKKTGRPIYNAIVWQSRQTTEICNQLYK
AGWQEYIRKTTGLVIDPYFSATKIKWILDHVEGSRERAERGELLFGTVDTWLIWKLTNGA
VHVTDFTNASRTMLFDIEKLEWDEKLLQALDIPRAMLPEVRSSSEVYGYTHTISGQEVGI
PIAGIAGDQQAALFGQMCVESGQAKNTYGTGCFLLMNTGKKIVRSEHGLLTTIACGASGE
VNYALEGAVFNGGSCVQWLRDELKVIKNAKDSELYATRVKDNNGVYVVPAFTGLGAPYWD
PTARGAIFGLTRGASIEHIIRATLESIAFQTRDVLDAMQQDAEEELRTLRVDGGVTENNF
LMQFQADILATPVERPIMKETTALGAAFLAGLATGFWQDLHELRNKSAIEKVFEPKMSSE
QSEMIYKGWLKAVKRSQSWAED
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaattgcccgaaaaaatatattgtcgcttttgatcagggaacaacaagctcaaga
gcaattgttttagatcatgatgcgaacgttgtcagtattgctcaaagagaatttacccag
atttaccctcagccaggttgggttgagcatgatcctatggaaatttgggcaactcaaagt
gctgtatgggtcgaagcattggctcaagctggcatcaagagtgaacaagttgcggcaatt
ggaattacaaaccaacgggaaaccactattgtctgggacaaaaaaacaggaagacctatt
tacaatgcgattgtttggcaaagccgacaaacaacggaaatatgcaatcaattgtataaa
gcaggttggcaagaatatatccgtaagaccactggtttagtcattgatccatatttctcg
gccacaaaaattaaatggattttggatcatgttgaaggcagccgtgagcgtgctgaacga
ggagagctattattcggtacggtggacacttggctgatttggaaactaactaatggggcc
gtccatgtcactgattttaccaatgcatctcgaaccatgctgtttgatatcgaaaagctt
gagtgggatgaaaagcttttacaagctttagacattcctagagcaatgttgccggaggtt
cgtagttcatctgaggtttatggatatacacataccattagtggacaagaagtaggaatc
ccaattgccggaatcgcgggtgatcagcaggctgcgctttttggtcaaatgtgtgttgag
tcgggacaggctaaaaatacctacggtactggctgttttctactcatgaatacgggtaaa
aagattgtccgttcagagcatggattactcacaactattgcctgtggtgcgagtggtgag
gtgaactatgccttagagggtgccgtatttaacggtggttcttgcgtacagtggttacgt
gatgaattaaaggttattaagaatgctaaggattccgagctttatgcaacacgtgtaaag
gataataatggtgtatatgtagtacctgcttttaccgggttaggagcaccgtattgggac
ccgacagctcgcggcgcaatttttggtctgacgcgtggggctagtattgaacatattatc
cgcgcaactctagagtctatagcctttcaaactcgggatgttttagatgccatgcaacaa
gatgcagaagaagagcttcgtacactccgtgtcgatggaggagtaacggaaaataatttc
ttaatgcaatttcaggctgatattttagcgacaccagtagaacgtccaataatgaaagaa
actactgctttgggtgcagctttccttgctgggctggcgacgggtttctggcaagatcta
catgagttaagaaataaatctgccatagaaaaggtatttgagccaaaaatgtcttctgag
caatctgagatgatttataagggttggctcaaggcagttaaacgtagtcaaagttgggct
gaggattag

DBGET integrated database retrieval system