KEGG   Acinetobacter baumannii 1656-2: ABK1_3012Help
Entry
ABK1_3012         CDS       T01819                                 

Definition
sdhD
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABK1_3012
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABK1_3012
   00650 Butanoate metabolism
    ABK1_3012
  Energy metabolism
   00190 Oxidative phosphorylation
    ABK1_3012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3189676..3190041)
Genome map
AA seq 121 aa AA seqDB search
MKSATGLTGSGSRDWFIQRVSAVVLAAYTVVLFGWILCKGGFDYQQWAGFMMTLPMKIFS
LLAILSLIAHAWIGMWQVFTDYVTTRQMGPSAKGLRLVLTTAVIIAVFVYAIWGIQIFWA
N
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtgctacaggtttaacaggttcaggttctcgtgattggtttatccagcgtgta
agtgctgtggtattggcagcttatactgttgttctttttggttggatcctctgcaaaggc
ggatttgactatcaacaatgggctggcttcatgatgacattaccaatgaagattttctct
ttattggcaattttgtcgcttatcgcacacgcatggattggtatgtggcaggtttttact
gactatgtcactactcgtcaaatgggtccttcagcgaaaggtttacgccttgtactgact
acggctgtcattattgcagtgtttgtgtacgcaatctggggtatccagattttctgggcg
aattga

DBGET integrated database retrieval system