KEGG   Acinetobacter baumannii 1656-2: ABK1_3012Help
Entry
ABK1_3012         CDS       T01819                                 

Definition
(GenBank) sdhD
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
abx00020  Citrate cycle (TCA cycle)
abx00190  Oxidative phosphorylation
abx00650  Butanoate metabolism
abx01100  Metabolic pathways
abx01110  Biosynthesis of secondary metabolites
abx01120  Microbial metabolism in diverse environments
abx01130  Biosynthesis of antibiotics
abx01200  Carbon metabolism
Module
abx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
abx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABK1_3012
   00650 Butanoate metabolism
    ABK1_3012
  Energy metabolism
   00190 Oxidative phosphorylation
    ABK1_3012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ADX04646
Position
complement(3189676..3190041)
Genome map
AA seq 121 aa AA seqDB search
MKSATGLTGSGSRDWFIQRVSAVVLAAYTVVLFGWILCKGGFDYQQWAGFMMTLPMKIFS
LLAILSLIAHAWIGMWQVFTDYVTTRQMGPSAKGLRLVLTTAVIIAVFVYAIWGIQIFWA
N
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtgctacaggtttaacaggttcaggttctcgtgattggtttatccagcgtgta
agtgctgtggtattggcagcttatactgttgttctttttggttggatcctctgcaaaggc
ggatttgactatcaacaatgggctggcttcatgatgacattaccaatgaagattttctct
ttattggcaattttgtcgcttatcgcacacgcatggattggtatgtggcaggtttttact
gactatgtcactactcgtcaaatgggtccttcagcgaaaggtttacgccttgtactgact
acggctgtcattattgcagtgtttgtgtacgcaatctggggtatccagattttctgggcg
aattga

DBGET integrated database retrieval system