KEGG   Acinetobacter baumannii 1656-2: ABK1_3175Help
Entry
ABK1_3175         CDS       T01819                                 

Definition
trpB
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:abx01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:abx00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:abx00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3364723..3365952)
Genome map
AA seq 409 aa AA seqDB search
MDQQNNVIDYTQFPDANGHFGIHGGRFVSETLMAALEDLENLYSRMKNDEQFLAEFDRDL
AYYVGRPSPLYYAERWSKELGGAQIYLKREDLNHTGSHKVNNTIGQALLAKLSGKKRIIA
ETGAGQHGVATATIAARLGLECVVYMGAEDVKRQAMNVYRMRLLGATVVPVQSGSKTLKD
AMNEAMRDWVTNVDTTYYVIGTVAGPHPYPQLVRDFQSIIGREARKQILEQAGRLPDALV
ACVGGGSNAMGLFYPFLNDASVKMYGVEAAGFGIETGKHSAPLNAGHVGVLHGNRTYLMS
DEQGQIIETHSISAGLDYPGVGPEHSFLKDMKRVEYVPINDTEALQGFRDLTKIEGIIPA
LESSHAMAYVSKLAPTMSKDQIIIATVSGRGDKDLMTVARIDGVEMVEM
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtggatcagcaaaataatgtgattgactatacccaattcccagatgcaaatgggcatttc
ggtatccatggcggacgttttgtgtcagaaactttaatggcggcattagaagatttggaa
aatctctattcccgcatgaaaaatgatgaacagtttttggcagaattcgaccgtgatctc
gcctactatgtaggtcgtcctagtccactttattatgctgagcgatggtcaaaagagtta
ggtggtgcgcaaatttaccttaaacgtgaagacttgaaccatacaggctcacacaaggta
aacaacacgattggtcaggcactacttgcaaagctttctggtaaaaaacgtattattgcc
gaaactggtgcaggccagcatggggtagcaacagcaacaattgcagcacgtttaggtctt
gaatgtgttgtttatatgggtgctgaagacgttaagcgtcaagcgatgaacgtttaccgt
atgcgtttgttaggtgcaacagttgtgcctgtgcaaagtggctctaaaacattaaaagat
gccatgaacgaagcgatgcgtgactgggtaaccaacgttgatacaacatattatgtcatt
ggtacagttgcaggtccgcatccttatcctcaacttgttcgtgacttccaatcaattatt
ggtcgtgaagcgcgtaaacagattttggaacaagcaggtcgcttaccagatgcattagtt
gcttgtgtaggtggtggttcaaatgcaatgggcttgttttatccgttcttaaacgatgcc
agtgtaaaaatgtatggggttgaagctgctggttttggtattgaaactggtaaacactct
gcgcctttaaatgcgggtcatgtgggtgtattacatggtaaccgtacttatttaatgagt
gatgaacagggccagattattgagacacacagtatctcggcgggccttgattatccgggt
gttggtcctgaacatagtttcttgaaagatatgaagcgtgtagagtacgtgccgattaat
gatacagaggctcttcaaggtttccgtgacttaaccaaaatcgaagggattattcctgcg
cttgaaagctcgcacgcgatggcgtatgtctctaagcttgcaccgacgatgtctaaagat
cagattattattgcgactgtttcaggccgtggcgataaagacttaatgacagttgcacgc
attgatggcgtagaaatggtcgagatgtaa

DBGET integrated database retrieval system