KEGG   Acinetobacter baumannii 1656-2: ABK1_3421Help
Entry
ABK1_3421         CDS       T01819                                 

Definition
gmk
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ABK1_3421
Enzymes [BR:abx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ABK1_3421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3617952..3618581
Genome map
AA seq 209 aa AA seqDB search
MSGLLFVVSAASGTGKTSLVKALLDRVSNLHVSVSHTTRGQRPGELDGVHYHFTTKDEFL
DQVNQGGFIEYAEVFGNYYGTSQATVKQQLAQGHDVLLEIDWQGAEQVRKLFPESKQIFI
LPPTQFDLRQRLSNRGTDSVEVIEHRLSCAVEDMQHYVNFDYIIINDDFNKALHELEAVI
TANRLVLSQQAKRHQNLIQDLITPQPKQE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggtctattgtttgtcgtttctgctgcatcaggaacgggcaaaacatctttggtg
aaagccctacttgaccgtgtgagcaatttacatgtttcagtttcgcatactacccgaggt
caacgaccaggtgagttagatggtgttcactatcacttcacaacaaaagatgaattttta
gaccaagtgaaccaaggtggatttatcgaatatgctgaagtatttggtaactactatggc
acttcgcaagcaaccgtaaaacaacagttagctcaaggacatgatgtcttgcttgaaatt
gactggcaaggtgcagagcaagtacgtaagctgtttcctgaatctaaacagatctttatt
ttaccacctactcaattcgatttacgtcaacgtttatctaaccgtggtacagactctgtt
gaagttattgaacaccgcttaagctgtgctgttgaagacatgcagcactatgtaaatttc
gactatatcatcattaatgatgactttaataaagccttacatgagcttgaagccgtcatt
acagcaaatcgtttagtcttatctcaacaggcaaaaagacatcaaaatctaattcaagac
ttgattactccacaaccaaaacaggaataa

DBGET integrated database retrieval system