KEGG   Acinetobacter baumannii 1656-2: ABK1_3451Help
Entry
ABK1_3451         CDS       T01819                                 

Definition
murE
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ABK1_3451
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ABK1_3451
Enzymes [BR:abx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     ABK1_3451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3651953..3653452)
Genome map
AA seq 499 aa AA seqDB search
MTVSFQEIHPIEIDAQWPQQPFHGFSLDSRKVETGQIFIALTSYSQPEKTRTFAEAALAN
GALAVISETELGVANEWVCPDVRQRMGEWQKRYLQQADVVKPLRIIAVTGTNGKTTISRL
IAELISSQQQRCAVMGTTGNGILPNLTPSTHTTLDALQLQNALHDYAKQGATFASLEASS
HGLEQGRLNGCDIEIAVYSNLSRDHLDYHGTLEAYAEAKARLFQFNSLKVAVINLDDAHA
DLMIKSAQNNPAQPKILTYSLTQNTADYYITDLSYSLAGATFNLVSQQGSFAVESPLLGH
FNVENLIAALIAAEQAGFDLQALVNFVPKLIGAPGRMQVIRDDERLFVVDYAHTPDALIQ
VLKTLKRHVSNQLWAVFGCGGDRDRGKRPLMTQAALDGANPVILTSDNPRTEDPEQIFAD
MKQGIDFSGHRMHEIHDRREAIKFVAEQAQAGDIVVIAGKGHENYQEINGVRHWFDDVVE
VRSAIDAQHHTVDAAYPAQ
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgactgtttcttttcaagaaattcatccaatcgaaattgatgctcaatggcctcaacag
ccatttcacggctttagtttagatagtcgtaaagttgaaacgggccaaatttttattgct
ttgacaagttatagccagcctgaaaaaacgcgtacatttgctgaagcggctttagcaaat
ggagcgttggctgtcattagcgaaaccgaattaggtgtagcaaatgaatgggtatgccct
gatgtgcgtcagcgcatgggagagtggcaaaaacgttatttgcaacaggctgatgtagta
aaacctttacggattatagctgtaacaggcacaaatggtaaaacaacaatttctcgttta
attgctgagttaattagttcacaacagcagcgctgtgcagtgatggggacaacagggaat
ggtattttacctaacttaacgccttctacgcatactaccctcgacgctctacagttacaa
aatgcgctacatgattatgctaaacagggagcaacttttgcttctttagaagcaagttca
catggtcttgaacagggtcgattaaatggttgcgatattgaaattgctgtttatagcaac
ttaagtcgtgaccatctggattatcatggcactttagaagcttatgcagaagcgaaggcg
cgtttatttcagtttaattcgttaaaagtcgctgttattaatttagatgatgcccatgct
gacttgatgattaagtctgcccaaaataatccagcacaacctaaaattttgacttactca
ctaactcaaaatacagctgattattacattaccgatttaagctatagcttggcgggtgca
acttttaatttagtaagtcagcaaggttcatttgcggtagaaagcccattattaggtcat
ttcaatgttgaaaatttaattgccgcactcatcgctgctgagcaagctggtttcgattta
caggcattggttaattttgttcctaaactaattggtgcgccaggccgaatgcaagttatt
cgtgatgatgagcgattatttgtagtggattatgcgcatacaccagatgcattgattcaa
gtgcttaaaacattaaagcgtcatgtttcgaatcagctttgggcggtgtttggatgtggt
ggtgaccgtgaccgtggtaagcgtccactcatgactcaagcagctttagatggcgcaaac
cctgttattctgacttcagataatccaagaacagaagaccctgaacaaatttttgctgat
atgaagcaaggaatcgatttttcagggcatcgtatgcatgaaattcatgaccgccgtgaa
gcaattaaatttgttgcagagcaagctcaagctggtgacattgtagtgattgctggtaaa
ggacatgaaaattatcaagaaattaatggtgtgcgtcactggtttgatgatgtggttgaa
gtgcgttccgcgattgatgcccaacatcatacggtagatgctgcttaccctgcacaatag

DBGET integrated database retrieval system